CD36 (Mus musculus)
Description [+]
- Synonyms: CD36,
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Platelet glycoprotein 4 (Platelet glycoprotein IV)(GPIV)(GPIIIB)(PAS IV)(PAS-4)(CD36 antigen) [Source:UniProtKB/Swiss-Prot;Acc:Q08857]
- Family: other
- Process: apoptosis,
- Pathways: apoptotic cell clearance,
- Criteria: manually curated
- Curator comment: Scavenger receptor which regocnizes oxidized PS on apoptotic cells.
- Human ortholog(s): CD36
- WIKI: CD36-M_musculus
References [+]
- Oxidized phosphatidylserine-CD36 interactions play an essential role in macrophage-dependent phagocytosis of apoptotic cells.
- Greenberg ME, Sun M, Zhang R, Febbraio M, Silverstein R, Hazen SL
- The phagocytosis of apoptotic cells within an organism is a critical terminal physiological process in programmed cell death. Evidence suggests that apoptotic cell engulfment and removal by macrophages is facilitated by phosphatidylserine (PS) displayed at the exofacial surface of the plasma membrane; however, neither the macrophage receptors responsible for PS recognition, nor characterization of the PS molecular species potentially involved, have been clearly defined. We show that the class B scavenger receptor CD36 plays an essential role in macrophage clearance of apoptotic cells in vivo. Further, macrophage recognition of apoptotic cells via CD36 is shown to occur via interactions with membrane-associated oxidized PS (oxPS) and, to a lesser extent, oxidized phosphatidylcholine, but not nonoxidized PS molecular species. Mass spectrometry analyses of oxPS species identify structures of candidate ligands for CD36 in apoptotic membranes that may facilitate macrophage recognition. Collectively, these results identify oxPS-CD36 interactions on macrophages as potential participants in a broad range of physiologic processes where macrophage-mediated engulfment of apoptotic cells is involved. J Exp Med. 2006 Nov 27;203(12):2613-25. Epub 2006 Nov 13.
- Apoptosis: controlled demolition at the cellular level.
- Taylor RC, Cullen SP, Martin SJ
- Apoptosis is characterized by a series of dramatic perturbations to the cellular architecture that contribute not only to cell death, but also prepare cells for removal by phagocytes and prevent unwanted immune responses. Much of what happens during the demolition phase of apoptosis is orchestrated by members of the caspase family of cysteine proteases. These proteases target several hundred proteins for restricted proteolysis in a controlled manner that minimizes damage and disruption to neighbouring cells and avoids the release of immunostimulatory molecules. Nat Rev Mol Cell Biol. 2008 Mar;9(3):231-41.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | CD36 | 12 | 465 |
Protein sequence [+]
Cd36 | Mus musculus | 10090 | length:472
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDMLIEKTIKREVVLEEGTTAFKNWVKTGTT
VYRQFWIFDVQNPDDVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGA
IFEPSLSVGTEDDNFTVLNLAVAAAPHIYQNSFVQVVLNSLIKKSKSSMFQTRSLKELLW
GYKDPFLSLVPYPISTTVGVFYPYNDTVDGVYKVFNGKDNISKVAIIESYKGKRNLSYWP
SYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEIDLKGIPVYRFVLPANAF
ASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGL
HPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETG
TIGDEKAEMFKTQVTGKIKLLGMVEMALLGIGVVMFVAFMISYCACKSKNGK
VYRQFWIFDVQNPDDVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGA
IFEPSLSVGTEDDNFTVLNLAVAAAPHIYQNSFVQVVLNSLIKKSKSSMFQTRSLKELLW
GYKDPFLSLVPYPISTTVGVFYPYNDTVDGVYKVFNGKDNISKVAIIESYKGKRNLSYWP
SYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEIDLKGIPVYRFVLPANAF
ASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGL
HPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETG
TIGDEKAEMFKTQVTGKIKLLGMVEMALLGIGVVMFVAFMISYCACKSKNGK
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| A_aegypti_AAEL005374-PA | orthology | Aedes |
| A_gambiae_AGAP005716-PA | orthology | Anopheles |
| A_gambiae_AGAP002451-PA | orthology | Anopheles |
| NP_001025902.1 | orthology | Chicken |
| CD36 | orthology | Chimpanzee |
| NA | orthology | Ciona |
| NA | orthology | Ciona |
| NP_001039704.1 | orthology | Cow |
| CD36_BOVIN | orthology | Cow |
| CD36 | orthology | Dog |
| D_melanogaster_FBpp0083430 | orthology | Fly |
| CG7422 | orthology | Fly |
| CD36 | orthology | Fugu |
| CD36 | orthology | Gasterosteus |
| CD36 | orthology | Gorilla |
| CD36 | orthology | Horse |
| CD36 | orthology | Human |
| CD36 | orthology | Lyzard |
| CD36 | orthology | Medaka |
| CD36 | orthology | Monodelphis |
| CD36 | orthology | Orangutan |
| CD36 | orthology | Ornithorhynchus |
| CD36 | orthology | Rabbit |
| CD36_RAT | orthology | Rat |
| NP_001102688.1 | orthology | Rat |
| CD36 | orthology | Tetraodon |
| Y49E10.20 | orthology | Worm |
| NP_510157.2 | orthology | Worm |
| Y76A2B.6 | orthology | Worm |
| YX13_CAEEL | orthology | Worm |
| NP_492081.1 | orthology | Worm |
| YRN3_CAEEL | orthology | Worm |
| X_tropicalis_ENSXETP00000017237 | orthology | Xenopus |
| X_tropicalis_ENSXETP00000017231 | orthology | Xenopus |
| T_guttata_ENSTGUP00000016695 | orthology | Zebra finch |
| CD36 | orthology | Zebra finch |
| cd36 | orthology | Zebrafish |
| A_aegypti_AAEL000227-PA | paralogy | Aedes |
| A_aegypti_AAEL007748-PA | paralogy | Aedes |
| A_aegypti_AAEL009423-PA | paralogy | Aedes |
| A_aegypti_AAEL009420-PA | paralogy | Aedes |
| A_aegypti_AAEL005979-PA | paralogy | Aedes |
| A_aegypti_AAEL008370-PA | paralogy | Aedes |
| A_aegypti_AAEL000234-PA | paralogy | Aedes |
| A_aegypti_AAEL009432-PA | paralogy | Aedes |
| A_aegypti_AAEL002741-PA | paralogy | Aedes |
| A_aegypti_AAEL000256-PA | paralogy | Aedes |
| A_aegypti_AAEL011222-PA | paralogy | Aedes |
| A_gambiae_AGAP004643-PA | paralogy | Anopheles |
| A_gambiae_AGAP004846-PB | paralogy | Anopheles |
| A_gambiae_AGAP002738-PA | paralogy | Anopheles |
| A_gambiae_AGAP008179-PA | paralogy | Anopheles |
| A_gambiae_AGAP004845-PA | paralogy | Anopheles |
| A_gambiae_AGAP012849-PA | paralogy | Anopheles |
| A_gambiae_AGAP005725-PA | paralogy | Anopheles |
| A_gambiae_AGAP010133-PA | paralogy | Anopheles |
| A_gambiae_AGAP010132-PA | paralogy | Anopheles |
| A_gambiae_AGAP000016-PA | paralogy | Anopheles |
| A_gambiae_AGAP003373-PA | paralogy | Anopheles |
| A_gambiae_AGAP004847-PA | paralogy | Anopheles |
| IPI00588351.3 | paralogy | Chicken |
| IPI00590957.2 | paralogy | Chicken |
| SCARB2 | paralogy | Chimpanzee |
| SCARB1 | paralogy | Chimpanzee |
| NA | paralogy | Ciona |
| NA | paralogy | Ciona |
| SCRB1_BOVIN | paralogy | Cow |
| NP_001095623.1 | paralogy | Cow |
| SCARB1 | paralogy | Dog |
| SCARB2 | paralogy | Dog |
| santa-maria | paralogy | Fly |
| pes | paralogy | Fly |
| CG3829 | paralogy | Fly |
| emp | paralogy | Fly |
| CG40006 | paralogy | Fly |
| CG2736 | paralogy | Fly |
| CG10345 | paralogy | Fly |
| crq | paralogy | Fly |
| CG31741 | paralogy | Fly |
| ninaD | paralogy | Fly |
| CG1887 | paralogy | Fly |
| CG7227 | paralogy | Fly |
| SCARB2 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000042953 | paralogy | Fugu |
| SCARB1 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000036580 | paralogy | Fugu |
| G_aculeatus_ENSGACP00000021517 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000018249 | paralogy | Gasterosteus |
| SCARB2 | paralogy | Gasterosteus |
| SCARB2 | paralogy | Gorilla |
| SCARB1 | paralogy | Gorilla |
| SCARB1 | paralogy | Horse |
| SCARB2 | paralogy | Horse |
| SCARB1 | paralogy | Human |
| SCARB2 | paralogy | Human |
| SCARB2 | paralogy | Lyzard |
| SCARB1 | paralogy | Lyzard |
| SCARB1 | paralogy | Macaca |
| SCARB2 | paralogy | Macaca |
| O_latipes_ENSORLP00000008151 | paralogy | Medaka |
| O_latipes_ENSORLP00000000458 | paralogy | Medaka |
| SCARB2 | paralogy | Medaka |
| SCARB1 | paralogy | Medaka |
| SCARB1 | paralogy | Monodelphis |
| SCARB2 | paralogy | Monodelphis |
| Scarb1 | paralogy | Mouse |
| Scarb2 | paralogy | Mouse |
| SCARB2 | paralogy | Orangutan |
| SCARB1 | paralogy | Orangutan |
| SCARB2 | paralogy | Ornithorhynchus |
| SCARB1 | paralogy | Ornithorhynchus |
| SCARB2 | paralogy | Rabbit |
| SCRB2_RAT | paralogy | Rat |
| SCRB1_RAT | paralogy | Rat |
| T_nigroviridis_ENSTNIP00000018658 | paralogy | Tetraodon |
| SCARB2 | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000010349 | paralogy | Tetraodon |
| SCARB1 | paralogy | Tetraodon |
| SCARB1 | paralogy | Xenopus |
| scarb2 | paralogy | Xenopus |
| SCARB1 | paralogy | Zebra finch |
| SCARB2 | paralogy | Zebra finch |
| scarb2 | paralogy | Zebrafish |
| D_rerio_ENSDARP00000071723 | paralogy | Zebrafish |
| scarb1 | paralogy | Zebrafish |
| D_rerio_ENSDARP00000076810 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006810 | transport | biological_proccess | IEA |
| GO:0007155 | cell adhesion | biological_proccess | IEA |
| GO:0010744 | positive regulation of foam cell differentiation | biological_proccess | IMP |
| GO:0010886 | positive regulation of cholesterol storage | biological_proccess | IMP |
| GO:0019915 | lipid storage | biological_proccess | IMP |
| GO:0030301 | cholesterol transport | biological_proccess | IDA |
| GO:0034381 | lipoprotein particle clearance | biological_proccess | IMP |
| GO:0042159 | lipoprotein catabolic process | biological_proccess | IMP |
| GO:0042953 | lipoprotein transport | biological_proccess | IMP |
| GO:0043277 | apoptotic cell clearance | biological_proccess | IMP |
| GO:0007263 | nitric oxide mediated signal transduction | biological_proccess | IEA |
| GO:0019934 | cGMP-mediated signaling | biological_proccess | IEA |
| GO:0001954 | positive regulation of cell-matrix adhesion | biological_proccess | IEA |
| GO:0015911 | plasma membrane long-chain fatty acid transport | biological_proccess | IEA |
| GO:0004872 | receptor activity | mollecular_function | IEA |
| GO:0005041 | low-density lipoprotein receptor activity | mollecular_function | IMP |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0008035 | high-density lipoprotein binding | mollecular_function | IDA |
| GO:0008289 | lipid binding | mollecular_function | ISS |
| GO:0008289 | lipid binding | mollecular_function | IEA |
| GO:0009986 | cell surface | cell_component | ISS |
| GO:0016020 | membrane | cell_component | IEA |
| GO:0016021 | integral to membrane | cell_component | IEA |
| GO:0005764 | lysosome | cell_component | IEA |
| GO:0005794 | Golgi apparatus | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMUSG00000002944
- Expression info from Arrayexpress [?] : ENSMUSG00000002944
- Protein expression from Protein Atlas: [?] ENSMUSG00000002944
Click on [?] for more information.
