FASLG (Danio rerio)
Description [+]
- Synonyms: FASLG, FAS LIGAND (TNF SUPERFAMILY, MEMBER 6), FASL, ZGC:162027
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: Fas ligand (TNF superfamily, member 6) [Source:RefSeq_peptide;Acc:NP_001036166]
- Family: Death ligand
- Process: undefined,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): FASL
- WIKI: FASLG-D_rerio
References [+]
- Delineation of the cell-extrinsic apoptosis pathway in the zebrafish.
- Eimon PM, Kratz E, Varfolomeev E, Hymowitz SG, Stern H, Zha J, Ashkenazi A
- The mammalian extrinsic apoptosis pathway is triggered by Fas ligand (FasL) and Apo2 ligand/tumor necrosis factor (TNF)-related apoptosis-inducing ligand (Apo2L/TRAIL). Ligand binding to cognate receptors activates initiator caspases directly in a death-inducing signaling complex. In Drosophila, TNF ligand binding activates initiator caspases indirectly, through JNK. We characterized the extrinsic pathway in zebrafish to determine how it operates in a nonmammalian vertebrate. We identified homologs of FasL and Apo2L/TRAIL, their receptors, and other components of the cell death machinery. Studies with three Apo2L/TRAIL homologs demonstrated that they bind the receptors zHDR (previously linked to hematopoiesis) and ovarian TNFR (zOTR). Ectopic expression of these ligands during embryogenesis induced apoptosis in erythroblasts and notochord cells. Inhibition of zHDR, zOTR, the adaptor zFADD, or caspase-8-like proteases blocked ligand-induced apoptosis, as did antiapoptotic Bcl-2 family members. Thus, the extrinsic apoptosis pathway in zebrafish closely resembles its mammalian counterpart and cooperates with the intrinsic pathway to trigger tissue-specific apoptosis during embryogenesis in response to ectopic Apo2L/TRAIL expression. Cell Death Differ. 2006 Oct;13(10):1619-30. Epub 2006 Aug 4.
- References from Human ortholog(s):
- Molecular cloning and expression of the Fas ligand, a novel member of the tumor necrosis factor family.
- Suda T, Takahashi T, Golstein P, Nagata S
- The Fas antigen (Fas) belongs to the tumor necrosis factor (TNF)/nerve growth factor receptor family, and it mediates apoptosis. Using a soluble form of mouse Fas, prepared by fusion with human immunoglobulin Fc, Fas ligand was detected on the cell surface of a cytotoxic T cell hybridoma, PC60-d10S. A cell population that highly expresses Fas ligand was sorted using a fluorescence-activated cell sorter, and its cDNA was isolated from the sorted cells by expression cloning. The amino acid sequence indicated that Fas ligand is a type II transmembrane protein that belongs to the TNF family. The recombinant Fas ligand expressed in COS cells induced apoptosis in Fas-expressing target cells. Northern hybridization revealed that Fas ligand is expressed in activated splenocytes and thymocytes, consistent with its involvement in T cell-mediated cytotoxicity and in several nonlymphoid tissues, such as testis. Cell. 1993 Dec 17;75(6):1169-78.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 145 | 267 |
Protein sequence [+]
faslg | Danio rerio | 7955 | length:268
MSANFGHSSQPVFMVDSAGNHPKQHRYYHQQVPRHPEPPLVPCWTFPPARVEMKKKGWGG
MNAGLAWVVTLILLLVFAALGLGAYQILRLQTKLEQLTQELPTIMQSSAPQKQVGLNPAE
LKKNKYKSAAHLIGYAEQSKSPGLLKWISNHGDAFTDGVKYTDGGLQVNETGLYFVYSRV
EFLSHTCKTFDSLAHKISLKRNGNSQIIMEDNIEGFCMTSKNHPWVTGSQLGSLQQLREL
DWLFVNVSRPHLLSKNFHSNYFGLFKIH
MNAGLAWVVTLILLLVFAALGLGAYQILRLQTKLEQLTQELPTIMQSSAPQKQVGLNPAE
LKKNKYKSAAHLIGYAEQSKSPGLLKWISNHGDAFTDGVKYTDGGLQVNETGLYFVYSRV
EFLSHTCKTFDSLAHKISLKRNGNSQIIMEDNIEGFCMTSKNHPWVTGSQLGSLQQLREL
DWLFVNVSRPHLLSKNFHSNYFGLFKIH
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
NP_001026730.1 | orthology | Chicken |
G_gallus_ENSGALP00000034816 | orthology | Chicken |
FASLG | orthology | Chimpanzee |
NP_001092329.1 | orthology | Cow |
Q9TTJ2_BOVIN | orthology | Cow |
NP_001092329.1 | orthology | Cow |
FASLG | orthology | Dog |
FASLG | orthology | Fugu |
FASLG | orthology | Horse |
FASL | orthology | Human |
TNFL6_MACMU | orthology | Macaca |
Fasl | orthology | Mouse |
FASLG | orthology | Orangutan |
FASLG | orthology | Ornithorhynchus |
Faslg | orthology | Rat |
FASLG | orthology | Tetraodon |
FASLG | orthology | Xenopus |
FASLG | orthology | Zebra finch |
A3RF19_CHICK | paralogy | Chicken |
TNFA_PANTR | paralogy | Chimpanzee |
TNFSF10 | paralogy | Chimpanzee |
TNFA_CANFA | paralogy | Dog |
TNFSF14 | paralogy | Gorilla |
TNFA_HORSE | paralogy | Horse |
TNF | paralogy | Human |
TNFSF10 | paralogy | Human |
H_sapiens_ENSP00000372988 | paralogy | Human |
H_sapiens_ENSP00000372790 | paralogy | Human |
TNFSF14 | paralogy | Lyzard |
O_latipes_ENSORLP00000020071 | paralogy | Medaka |
CD40LG | paralogy | Monodelphis |
TNF | paralogy | Monodelphis |
TRAIL | paralogy | Mouse |
TNFSF10 | paralogy | Orangutan |
TNFSF14 | paralogy | Ornithorhynchus |
TNFSF15 | paralogy | Rabbit |
Tnfsf10 | paralogy | Rat |
CD40LG | paralogy | Xenopus |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-070410-16
- Ensembl genome browser [?] : ENSDARG00000011520
- Expression info from Arrayexpress [?] : ENSDARG00000011520
- Protein expression from Protein Atlas: [?] ENSDARG00000011520
- Community gene edition from Wikigenes: [?] 735295
- entrezgene: 735295
- refseq_dna: NM_001042701
- refseq_peptide: NP_001036166
Click on [?] for more information.