BOKB (Danio rerio)
Description [+]
- Synonyms: BOKB, BCL2-RELATED OVARIAN KILLER B, ZBOK2, ZGC:64041
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: Bcl-2-related ovarian killer protein homolog B (zBok2). [Source:UniProtKB/Swiss-Prot;Acc:Q7T381]
- Family: Bcl-2 family : multidomain Bcl-2
- Process: undefined,
- Pathways: intrinsic pathway,
- Criteria: manually curated
- Curator comment:
- WIKI: BOKB-D_rerio
References [+]
- Functional characterization of the Bcl-2 gene family in the zebrafish.
- Kratz E, Eimon PM, Mukhyala K, Stern H, Zha J, Strasser A, Hart R, Ashkenazi A
- Members of the Bcl-2 protein family control the intrinsic apoptosis pathway. To evaluate the importance of this family in vertebrate development, we investigated it in the zebrafish (Danio rerio). We found that the zebrafish genome encodes structural and functional homologs of most mammalian Bcl-2 family members, including multi-Bcl-2-homology (BH) domain proteins and BH3-only proteins. Apoptosis induction by gamma-irradiation required zBax1 and zPuma, and could be prevented by overexpression of homologs of prosurvival Bcl-2 family members. Surprisingly, zebrafish Bax2 (zBax2) was homologous to mammalian Bax by sequence and synteny, yet demonstrated functional conservation with human Bak. Morpholino knockdown of both zMcl-1a and zMcl-1b revealed their critical role in early embryonic zebrafish development, and in the modulation of apoptosis activation through the extrinsic pathway. These data indicate substantial functional similarity between zebrafish and mammalian Bcl-2 family members, and establish the zebrafish as a relevant model for studying the intrinsic apoptosis pathway. Cell Death Differ. 2006 Oct;13(10):1631-40. Epub 2006 Aug 4.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2 | 71 | 183 |
Protein sequence [+]
bokb | Danio rerio | 7955 | length:222
MNVFARSSVLAAEMMDVFDRTHTEKELVFQSKELCRDFIHSRITREGLSWSKVELDLPEP
RGVLVDVSVVLLKLGDELECMRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAMDYA
TNTVFDFKGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKR
GGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK
RGVLVDVSVVLLKLGDELECMRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAMDYA
TNTVFDFKGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKR
GGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
A_aegypti_AAEL001515-PA | orthology | Aedes |
A_aegypti_AAEL001521-PA | orthology | Aedes |
Q2PHG8_ANOGA | orthology | Anopheles |
debcl | orthology | Fly |
Buffy | orthology | Fly |
BOK (2 of 2) | orthology | Fugu |
BOK (2 of 2) | orthology | Gasterosteus |
BOK (2 of 2) | orthology | Medaka |
BOK (2 of 2) | orthology | Tetraodon |
BOK_CHICK | paralogy | Chicken |
BCLX_CHICK | paralogy | Chicken |
BCL2L1 | paralogy | Chimpanzee |
C_intestinalis_ENSCINP00000016140 | paralogy | Ciona |
C_intestinalis_ENSCINP00000019812 | paralogy | Ciona |
NP_001070954.1 | paralogy | Cow |
NP_001092338.1 | paralogy | Cow |
BAX_BOVIN | paralogy | Cow |
NP_001003072.1 | paralogy | Dog |
BCL2L1 (1 of 6) | paralogy | Fugu |
BOK (1 of 2) | paralogy | Fugu |
BCL2L1 (2 of 6) | paralogy | Fugu |
BAX | paralogy | Fugu |
BCL2L1 (1 of 2) | paralogy | Gasterosteus |
BOK (1 of 2) | paralogy | Gasterosteus |
BAX | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000018978 | paralogy | Gasterosteus |
BOK | paralogy | Gorilla |
BOK | paralogy | Horse |
BCL2L1 | paralogy | Horse |
BAX | paralogy | Human |
BOK | paralogy | Human |
BCL2L1 | paralogy | Human |
BOK | paralogy | Lyzard |
BCL2L1 | paralogy | Lyzard |
BAX | paralogy | Macaca |
BOK | paralogy | Macaca |
BCL2L1 | paralogy | Macaca |
BOK (1 of 2) | paralogy | Medaka |
BCL2 | paralogy | Medaka |
BAX | paralogy | Monodelphis |
BOK | paralogy | Monodelphis |
BCL2L1 | paralogy | Monodelphis |
Bax | paralogy | Mouse |
Bcl2l1 | paralogy | Mouse |
Bok | paralogy | Mouse |
BCL2L1 | paralogy | Orangutan |
BOK | paralogy | Orangutan |
BOK | paralogy | Ornithorhynchus |
Q9MYW4_RABIT | paralogy | Rabbit |
Bok | paralogy | Rat |
Bax | paralogy | Rat |
BCLX_RAT | paralogy | Rat |
BOK (1 of 2) | paralogy | Tetraodon |
BCL2L1 (1 of 3) | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000017211 | paralogy | Tetraodon |
bax | paralogy | Xenopus |
BOK | paralogy | Zebra finch |
BCL2L1 | paralogy | Zebra finch |
boka | paralogy | Zebrafish |
zgc:153993 | paralogy | Zebrafish |
bcl2l | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0003674 | molecular_function | mollecular_function | ND |
GO:0005575 | cellular_component | cell_component | ND |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-040426-1346
- Ensembl genome browser [?] : ENSDARG00000008807
- Expression info from Arrayexpress [?] : ENSDARG00000008807
- Protein expression from Protein Atlas: [?] ENSDARG00000008807
- Community gene edition from Wikigenes: [?] 394160
Click on [?] for more information.