PHAP (Homo sapiens)
Description [+]
- Synonyms: PHAP, PHAP, ANP32A, LANP, PP32, I1PP2A, PHAPI, MAPM, MAPMODULIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Acidic leucine-rich nuclear phosphoprotein 32 family member A (Potent heat-stable protein phosphatase 2A inhibitor I1PP2A)(Acidic nuclear phosphoprotein pp32)(Leucine-rich acidic nuclear protein)(Lanp)(Putative HLA-DR-associated protein I)(PHAPI)(Mapmodulin) [Source:UniProtKB/Swiss-Prot;Acc:P39687]
- Family: Other
- Process: apoptosis,
- Pathways: post-mitochondrial caspase activation,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Anp32a
- WIKI: PHAP-H_sapiens
References [+]
- Distinctive roles of PHAP proteins and prothymosin-alpha in a death regulatory pathway.
- Jiang X, Kim HE, Shu H, Zhao Y, Zhang H, Kofron J, Donnelly J, Burns D, Ng SC, Rosenberg S, Wang X
- A small molecule, alpha-(trichloromethyl)-4-pyridineethanol (PETCM), was identified by high-throughput screening as an activator of caspase-3 in extracts of a panel of cancer cells. PETCM was used in combination with biochemical fractionation to identify a pathway that regulates mitochondria-initiated caspase activation. This pathway consists of tumor suppressor putative HLA-DR-associated proteins (PHAP) and oncoprotein prothymosin-alpha (ProT). PHAP proteins promoted caspase-9 activation after apoptosome formation, whereas ProT negatively regulated caspase-9 activation by inhibiting apoptosome formation. PETCM relieved ProT inhibition and allowed apoptosome formation at a physiological concentration of deoxyadenosine triphosphate. Elimination of ProT expression by RNA interference sensitized cells to ultraviolet irradiation-induced apoptosis and negated the requirement of PETCM for caspase activation. Thus, this chemical-biological combinatory approach has revealed the regulatory roles of oncoprotein ProT and tumor suppressor PHAP in apoptosis. Science. 2003 Jan 10;299(5604):223-6.
Structure & Sequence [+]
Protein sequence [+]
PHAP | Homo sapiens | 9606 | length:249
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL
PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD
EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD
PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD
EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| A_aegypti_AAEL001605-PA | orthology | Aedes |
| A_gambiae_AGAP005075-PB | orthology | Anopheles |
| G_gallus_ENSGALP00000013053 | orthology | Chicken |
| C_intestinalis_ENSCINP00000018746 | orthology | Ciona |
| AN32A_BOVIN | orthology | Cow |
| AN32A_CANFA | orthology | Dog |
| Mapmodulin | orthology | Fly |
| ANP32C | orthology | Fugu |
| ANP32C | orthology | Gasterosteus |
| ANP32C | orthology | Gorilla |
| E_caballus_ENSECAP00000002350 | orthology | Horse |
| A_carolinensis_ENSACAP00000013586 | orthology | Lyzard |
| M_mulatta_ENSMMUP00000029913 | orthology | Macaca |
| ANP32C | orthology | Medaka |
| M_domestica_ENSMODP00000034651 | orthology | Monodelphis |
| Anp32a | orthology | Mouse |
| ANP32A | orthology | Orangutan |
| O_anatinus_ENSOANP00000021355 | orthology | Ornithorhynchus |
| O_cuniculus_ENSOCUP00000000076 | orthology | Rabbit |
| Anp32a | orthology | Rat |
| R_norvegicus_ENSRNOP00000043155 | orthology | Rat |
| ANP32C | orthology | Tetraodon |
| F33H2.3 | orthology | Worm |
| F43G6.3 | orthology | Worm |
| T19H12.2 | orthology | Worm |
| anp32a | orthology | Xenopus |
| B5FYC6_TAEGU | orthology | Zebra finch |
| anp32a | orthology | Zebrafish |
| A_aegypti_AAEL012656-PD | paralogy | Aedes |
| A_aegypti_AAEL006840-PA | paralogy | Aedes |
| A_gambiae_AGAP007670-PB | paralogy | Anopheles |
| AN32B_CHICK | paralogy | Chicken |
| Q5ZKP1_CHICK | paralogy | Chicken |
| AN32E_CHICK | paralogy | Chicken |
| ANP32C | paralogy | Chimpanzee |
| LRRC6 | paralogy | Chimpanzee |
| ANP32B | paralogy | Chimpanzee |
| XR_022559.1 | paralogy | Chimpanzee |
| XR_020632.1 | paralogy | Chimpanzee |
| ANP32E | paralogy | Chimpanzee |
| C_intestinalis_ENSCINP00000011422 | paralogy | Ciona |
| NP_001092418.1 | paralogy | Cow |
| NP_001068774.1 | paralogy | Cow |
| AN32B_BOVIN | paralogy | Cow |
| ANP32B | paralogy | Dog |
| C_familiaris_ENSCAFP00000015542 | paralogy | Dog |
| ANP32E | paralogy | Dog |
| U2A | paralogy | Fly |
| SNRPA1 | paralogy | Fugu |
| ANP32E (2 of 2) | paralogy | Fugu |
| T_rubripes_ENSTRUP00000019528 | paralogy | Fugu |
| ANP32E (1 of 2) | paralogy | Fugu |
| LRRC9 | paralogy | Fugu |
| ANP32B | paralogy | Fugu |
| LRRC61 | paralogy | Gasterosteus |
| ANP32B | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000024521 | paralogy | Gasterosteus |
| ANP32E (2 of 2) | paralogy | Gasterosteus |
| ANP32E (1 of 2) | paralogy | Gasterosteus |
| G_gorilla_ENSGGOP00000000179 | paralogy | Gorilla |
| G_gorilla_ENSGGOP00000008764 | paralogy | Gorilla |
| ANP32B | paralogy | Gorilla |
| ANP32E | paralogy | Gorilla |
| LRRC6 | paralogy | Horse |
| ANP32E | paralogy | Horse |
| ANP32B | paralogy | Horse |
| E_caballus_ENSECAP00000017313 | paralogy | Horse |
| LRRC6 | paralogy | Human |
| SNRPA1 | paralogy | Human |
| ANP32D | paralogy | Human |
| ANP32E | paralogy | Human |
| ANP32C | paralogy | Human |
| ANP32B | paralogy | Human |
| A_carolinensis_ENSACAP00000003100 | paralogy | Lyzard |
| ANP32B | paralogy | Lyzard |
| ANP32E | paralogy | Lyzard |
| M_mulatta_ENSMMUP00000015518 | paralogy | Macaca |
| ANP32B | paralogy | Macaca |
| Q3YAN1_MACMU | paralogy | Macaca |
| LRRC6 | paralogy | Macaca |
| ANP32E (1 of 2) | paralogy | Medaka |
| ANP32B | paralogy | Medaka |
| O_latipes_ENSORLP00000025080 | paralogy | Medaka |
| ANP32E (2 of 2) | paralogy | Medaka |
| ANP32B | paralogy | Monodelphis |
| M_domestica_ENSMODP00000004440 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000015061 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000019786 | paralogy | Monodelphis |
| ANP32E | paralogy | Monodelphis |
| Anp32b | paralogy | Mouse |
| Anp32e | paralogy | Mouse |
| Snrpa1 | paralogy | Mouse |
| Q5RAC3_PONPY | paralogy | Orangutan |
| ANP32D | paralogy | Orangutan |
| ANP32C | paralogy | Orangutan |
| P_pygmaeus_ENSPPYP00000007744 | paralogy | Orangutan |
| P_pygmaeus_ENSPPYP00000013309 | paralogy | Orangutan |
| LRRC6 | paralogy | Orangutan |
| ANP32B | paralogy | Orangutan |
| ANP32E | paralogy | Ornithorhynchus |
| ANP32B | paralogy | Ornithorhynchus |
| O_anatinus_ENSOANP00000018632 | paralogy | Ornithorhynchus |
| O_anatinus_ENSOANP00000020934 | paralogy | Ornithorhynchus |
| O_cuniculus_ENSOCUP00000003696 | paralogy | Rabbit |
| ANP32B | paralogy | Rabbit |
| O_cuniculus_ENSOCUP00000005451 | paralogy | Rabbit |
| O_cuniculus_ENSOCUP00000008041 | paralogy | Rabbit |
| O_cuniculus_ENSOCUP00000011938 | paralogy | Rabbit |
| Snrpa1 | paralogy | Rat |
| Anp32e | paralogy | Rat |
| Q9QZM6-2 | paralogy | Rat |
| Anp32b | paralogy | Rat |
| ANP32E (1 of 2) | paralogy | Tetraodon |
| ANP32E (2 of 2) | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000008152 | paralogy | Tetraodon |
| SNRPA1 | paralogy | Tetraodon |
| ANP32B | paralogy | Tetraodon |
| BC064864.1 | paralogy | Xenopus |
| anp32b | paralogy | Xenopus |
| anp32e | paralogy | Xenopus |
| T_guttata_ENSTGUP00000000363 | paralogy | Zebra finch |
| ANP32E | paralogy | Zebra finch |
| B5FXA8_TAEGU | paralogy | Zebra finch |
| anp32b | paralogy | Zebrafish |
| anp32e | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0007242 | intracellular signaling cascade | biological_proccess | TAS |
| GO:0045449 | regulation of transcription | biological_proccess | IEA |
| GO:0006913 | nucleocytoplasmic transport | biological_proccess | NAS |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0005783 | endoplasmic reticulum | cell_component | IDA |
| GO:0005634 | nucleus | cell_component | IDA |
| GO:0048471 | perinuclear region of cytoplasm | cell_component | IDA |
| GO:0005737 | cytoplasm | cell_component | IDA |
Check GO Evidence Codes here
Curated Isoforms [+]
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :13233
- Gene related info from GeneCards [?] : PHAP
- Ensembl genome browser [?] : ENSG00000140350
- Expression info from Arrayexpress [?] : ENSG00000140350
- Protein expression from Protein Atlas: [?] ENSG00000140350
- Community gene edition from Wikigenes: [?] 8125
- OMIM gene information: 600832
- OMIM disease information:
Click on [?] for more information.
