CASP3B (Danio rerio)
Description [+]
- Synonyms: CASP3B, CASPASE 3, APOPTOSIS-RELATED CYSTEINE PROTEASE B, CASPASE-3B, CASP3B, CASP3L
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: caspase 3, apoptosis-related cysteine protease b [Source:RefSeq_peptide;Acc:NP_001041531]
- Family: Caspase
- Process: apoptosis,
- Pathways: undefined,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): CASP3
- WIKI: CASP3B-D_rerio
References [+]
- Delineation of the cell-extrinsic apoptosis pathway in the zebrafish.
- Eimon PM, Kratz E, Varfolomeev E, Hymowitz SG, Stern H, Zha J, Ashkenazi A
- The mammalian extrinsic apoptosis pathway is triggered by Fas ligand (FasL) and Apo2 ligand/tumor necrosis factor (TNF)-related apoptosis-inducing ligand (Apo2L/TRAIL). Ligand binding to cognate receptors activates initiator caspases directly in a death-inducing signaling complex. In Drosophila, TNF ligand binding activates initiator caspases indirectly, through JNK. We characterized the extrinsic pathway in zebrafish to determine how it operates in a nonmammalian vertebrate. We identified homologs of FasL and Apo2L/TRAIL, their receptors, and other components of the cell death machinery. Studies with three Apo2L/TRAIL homologs demonstrated that they bind the receptors zHDR (previously linked to hematopoiesis) and ovarian TNFR (zOTR). Ectopic expression of these ligands during embryogenesis induced apoptosis in erythroblasts and notochord cells. Inhibition of zHDR, zOTR, the adaptor zFADD, or caspase-8-like proteases blocked ligand-induced apoptosis, as did antiapoptotic Bcl-2 family members. Thus, the extrinsic apoptosis pathway in zebrafish closely resembles its mammalian counterpart and cooperates with the intrinsic pathway to trigger tissue-specific apoptosis during embryogenesis in response to ectopic Apo2L/TRAIL expression. Cell Death Differ. 2006 Oct;13(10):1619-30. Epub 2006 Aug 4.
- References from Human ortholog(s):
- CPP32, a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein Ced-3 and mammalian interleukin-1 beta-converting enzyme.
- Fernandes-Alnemri T, Litwack G, Alnemri ES
- We have cloned a novel apoptotic gene from human Jurkat T-lymphocytes. The new gene encodes a 32-kDa putative cysteine protease (CPP32) with significant homology to Caenorhabditis elegans cell death protein Ced-3, mammalian interleukin-1 beta-converting enzyme (ICE), and the product of the mouse nedd2 gene. The CPP32 transcript is highly expressed and most abundant in cell lines of lymphocytic origin. Overexpression of CPP32 or ICE in Sf9 insect cells resulted in apoptosis. In addition, coexpression of recombinant p20 and p11 derived from the parental full-length CPP32 sequence resulted in apoptosis in Sf9 cells. Our data suggest that similar to ICE, CPP32 is made of two subunits, p20 and p11, which form the active CPP32 complex. The apoptotic activity of CPP32 and its high expression in lymphocytes suggest that CPP32 is an important mediator of apoptosis in the immune system. J Biol Chem. 1994 Dec 9;269(49):30761-4.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 55 | 283 |
Protein sequence [+]
casp3b | Danio rerio | 7955 | length:285
MSDVKPKGVDTVDARQSDAKESSSVTDPGLVQMDAKSHSDDNVDYQYKTNYPNLGQCLII
NNKNFHKRTGMGVRNGTDEDAKKVFETFSQLGFKVGHYNDLTVSQMMALLNKASQEDHSK
SAMFACVLLSHGDDGLIYGTDNSIELKRLFAHFRGDRCTSLVGKPKLFFIQACRGTDLDS
GIECDGVGDEETQRIPVEADFLYAYSTAPGYYAWRNVANGSWFISSLCDMLLKYGKQLEI
MQVMTRVNHKVALEFESSSNLPGFDGKKQIPCIVSMLTKELYFPK
NNKNFHKRTGMGVRNGTDEDAKKVFETFSQLGFKVGHYNDLTVSQMMALLNKASQEDHSK
SAMFACVLLSHGDDGLIYGTDNSIELKRLFAHFRGDRCTSLVGKPKLFFIQACRGTDLDS
GIECDGVGDEETQRIPVEADFLYAYSTAPGYYAWRNVANGSWFISSLCDMLLKYGKQLEI
MQVMTRVNHKVALEFESSSNLPGFDGKKQIPCIVSMLTKELYFPK
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
NP_990056.1 | orthology | Chicken |
CASP3_PANTR | orthology | Chimpanzee |
CASP3_BOVIN | orthology | Cow |
CASP3_CANFA | orthology | Dog |
Q3S2Z5_HORSE | orthology | Horse |
CASP3 | orthology | Human |
CASP3 | orthology | Lyzard |
M_mulatta_ENSMMUP00000033547 | orthology | Macaca |
Q8SPU2_MACMU | orthology | Macaca |
NP_001033059.1 | orthology | Monodelphis |
NP_001033061.1 | orthology | Monodelphis |
M_domestica_ENSMODP00000005512 | orthology | Monodelphis |
Casp3 | orthology | Mouse |
CASP3 | orthology | Orangutan |
CASP3 | orthology | Ornithorhynchus |
CASP3 | orthology | Rabbit |
Casp3 | orthology | Rat |
R_norvegicus_ENSRNOP00000040783 | orthology | Rat |
CASP3 | orthology | Xenopus |
CASP3 | orthology | Zebra finch |
A_aegypti_AAEL003439-PA | paralogy | Aedes |
A_aegypti_AAEL014348-PA | paralogy | Aedes |
A_aegypti_AAEL012143-PA | paralogy | Aedes |
A_aegypti_AAEL003444-PA | paralogy | Aedes |
CASPS4 | paralogy | Anopheles |
CASPS8 | paralogy | Anopheles |
CASPS11 | paralogy | Anopheles |
CASPS5 | paralogy | Anopheles |
CASPS6 | paralogy | Anopheles |
CASPS7 | paralogy | Anopheles |
A_gambiae_AGAP012945-PA | paralogy | Anopheles |
CASPS2 | paralogy | Anopheles |
CASPS3 | paralogy | Anopheles |
CASPS1 | paralogy | Anopheles |
CASP7 | paralogy | Chicken |
Q90WU0_CHICK | paralogy | Chicken |
CASP10 | paralogy | Chicken |
NP_990057.1 | paralogy | Chicken |
NP_001038154.1 | paralogy | Chicken |
NP_989923.1 | paralogy | Chicken |
CASP8 | paralogy | Chimpanzee |
CASP7 | paralogy | Chimpanzee |
CASP6 | paralogy | Chimpanzee |
CASP9 | paralogy | Chimpanzee |
C_intestinalis_ENSCINP00000011493 | paralogy | Ciona |
C_intestinalis_ENSCINP00000003204 | paralogy | Ciona |
C_intestinalis_ENSCINP00000025905 | paralogy | Ciona |
C_intestinalis_ENSCINP00000028692 | paralogy | Ciona |
C_intestinalis_ENSCINP00000025743 | paralogy | Ciona |
C_intestinalis_ENSCINP00000011503 | paralogy | Ciona |
C_intestinalis_ENSCINP00000024485 | paralogy | Ciona |
IPI00704513.4 | paralogy | Cow |
NP_001039435.1 | paralogy | Cow |
IPI00689801.3 | paralogy | Cow |
CASP6_BOVIN | paralogy | Cow |
CASP7 | paralogy | Dog |
CASP6 | paralogy | Dog |
Q38JA9_CANFA | paralogy | Dog |
CASP10 | paralogy | Dog |
Dcp-1 | paralogy | Fly |
Ice | paralogy | Fly |
decay | paralogy | Fly |
CASP7 | paralogy | Fugu |
NP_001027871.1 | paralogy | Fugu |
CASP6 | paralogy | Fugu |
T_rubripes_ENSTRUP00000047737 | paralogy | Fugu |
G_aculeatus_ENSGACP00000023872 | paralogy | Gasterosteus |
CASP3 (4 of 4) | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000005791 | paralogy | Gasterosteus |
CASP3 (3 of 4) | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000016983 | paralogy | Gasterosteus |
CASP7 | paralogy | Gasterosteus |
CASP3 (2 of 4) | paralogy | Gasterosteus |
CASP3 (1 of 4) | paralogy | Gasterosteus |
CASP6 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000002479 | paralogy | Gasterosteus |
CASP8 | paralogy | Gorilla |
CASP7 | paralogy | Gorilla |
CASP7 | paralogy | Horse |
CASP8 | paralogy | Horse |
CASP10 | paralogy | Horse |
CASP6 | paralogy | Horse |
CASP9 | paralogy | Horse |
CASP6 | paralogy | Human |
CASP7 | paralogy | Human |
CASP9 | paralogy | Human |
CASP10 | paralogy | Human |
CASP8 | paralogy | Human |
CASP7 | paralogy | Lyzard |
CASP6 | paralogy | Lyzard |
CASP10 | paralogy | Lyzard |
CASP8 | paralogy | Macaca |
CASP10 | paralogy | Macaca |
CASP7 | paralogy | Macaca |
Q8JIS9_ORYLA | paralogy | Medaka |
CASP7 | paralogy | Medaka |
Q8JIS8_ORYLA | paralogy | Medaka |
CASP6 | paralogy | Monodelphis |
CASP8 | paralogy | Monodelphis |
CASP7 | paralogy | Monodelphis |
CASP9 | paralogy | Monodelphis |
Casp6 | paralogy | Mouse |
Casp9 | paralogy | Mouse |
Casp7 | paralogy | Mouse |
Casp8 | paralogy | Mouse |
CASP7 | paralogy | Orangutan |
CASP6 | paralogy | Orangutan |
CASP9 | paralogy | Orangutan |
Q5RB11_PONPY | paralogy | Orangutan |
Q5RCR7_PONPY | paralogy | Orangutan |
CASP10 | paralogy | Ornithorhynchus |
CASP6 | paralogy | Ornithorhynchus |
CASP9 | paralogy | Ornithorhynchus |
CASP7 | paralogy | Ornithorhynchus |
CASP8 | paralogy | Ornithorhynchus |
CASP10 | paralogy | Rabbit |
CASP6 | paralogy | Rabbit |
CASP7 | paralogy | Rabbit |
CASP8 | paralogy | Rabbit |
Casp7 | paralogy | Rat |
Casp8 | paralogy | Rat |
Casp9 | paralogy | Rat |
Casp6 | paralogy | Rat |
T_nigroviridis_ENSTNIP00000001216 | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000016604 | paralogy | Tetraodon |
CASP7 | paralogy | Tetraodon |
CASP6 | paralogy | Tetraodon |
CASP9 | paralogy | Tetraodon |
CASP3 | paralogy | Tetraodon |
ced-3 | paralogy | Worm |
casp7 | paralogy | Xenopus |
casp10 | paralogy | Xenopus |
casp6 | paralogy | Xenopus |
T_guttata_ENSTGUP00000011206 | paralogy | Zebra finch |
CASP9 | paralogy | Zebra finch |
T_guttata_ENSTGUP00000004278 | paralogy | Zebra finch |
CASP8 | paralogy | Zebra finch |
T_guttata_ENSTGUP00000014729 | paralogy | Zebra finch |
NP_001077331.1 | paralogy | Zebrafish |
LOC100000522 | paralogy | Zebrafish |
casp6l2 | paralogy | Zebrafish |
A2BGE2_DANRE | paralogy | Zebrafish |
casp7 | paralogy | Zebrafish |
casp6 | paralogy | Zebrafish |
casp3a | paralogy | Zebrafish |
casp8l1 | paralogy | Zebrafish |
casp6l1 | paralogy | Zebrafish |
casp8l2 | paralogy | Zebrafish |
LOC798445 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-070607-1
- Ensembl genome browser [?] : ENSDARG00000055045
- Expression info from Arrayexpress [?] : ENSDARG00000055045
- Protein expression from Protein Atlas: [?] ENSDARG00000055045
- Community gene edition from Wikigenes: [?] 566604
- entrezgene: 566604
- entrezgene: 791916
- refseq_dna: NM_001048066
- refseq_peptide: NP_001041531
Click on [?] for more information.