PARP2 (Mus musculus)
Description [+]
- Synonyms: PARP2, PARP2, POLY (ADP-RIBOSE) POLYMERASE FAMILY, MEMBER 2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: poly (ADP-ribose) polymerase family, member 2 Gene [Source:MGI Symbol;Acc:MGI:1341112]
- Family: other
- Process: necroptosis,
- Pathways:
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): PARP2
- WIKI: PARP2-M_musculus
References [+]
- PARP-2, A novel mammalian DNA damage-dependent poly(ADP-ribose) polymerase.
- Ame JC, Rolli V, Schreiber V, Niedergang C, Apiou F, Decker P, Muller S, Hoger T, Menissier-de Murcia J, de Murcia G
- Poly(ADP-ribosylation) is a post-translational modification of nuclear proteins in response to DNA damage that activates the base excision repair machinery. Poly(ADP-ribose) polymerase which we will now call PARP-1, has been the only known enzyme of this type for over 30 years. Here, we describe a cDNA encoding a 62-kDa protein that shares considerable homology with the catalytic domain of PARP-1 and also contains a basic DNA-binding domain. We propose to call this enzyme poly(ADP-ribose) polymerase 2 (PARP-2). The PARP-2 gene maps to chromosome 14C1 and 14q11.2 in mouse and human, respectively. Purified recombinant mouse PARP-2 is a damaged DNA-binding protein in vitro and catalyzes the formation of poly(ADP-ribose) polymers in a DNA-dependent manner. PARP-2 displays automodification properties similar to PARP-1. The protein is localized in the nucleus in vivo and may account for the residual poly(ADP-ribose) synthesis observed in PARP-1-deficient cells, treated with alkylating agents or hydrogen peroxide. J Biol Chem. 1999 Jun 18;274(25):17860-8.
- Identification of a molecular signaling network that regulates a cellular necrotic cell death pathway.
- Hitomi J, Christofferson DE, Ng A, Yao J, Degterev A, Xavier RJ, Yuan J
- Stimulation of death receptors by agonists such as FasL and TNFalpha activates apoptotic cell death in apoptotic-competent conditions or a type of necrotic cell death dependent on RIP1 kinase, termed necroptosis, in apoptotic-deficient conditions. In a genome-wide siRNA screen for regulators of necroptosis, we identify a set of 432 genes that regulate necroptosis, a subset of 32 genes that act downstream and/or as regulators of RIP1 kinase, 32 genes required for death-receptor-mediated apoptosis, and 7 genes involved in both necroptosis and apoptosis. We show that the expression of subsets of the 432 genes is enriched in the immune and nervous systems, and cellular sensitivity to necroptosis is regulated by an extensive signaling network mediating innate immunity. Interestingly, Bmf, a BH3-only Bcl-2 family member, is required for death-receptor-induced necroptosis. Our study defines a cellular signaling network that regulates necroptosis and the molecular bifurcation that controls apoptosis and necroptosis. Cell. 2008 Dec 26;135(7):1311-23.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | WGR | 90 | 175 |
PFAM A | PARP_reg | 207 | 339 |
PFAM A | PARP | 341 | 553 |
Protein sequence [+]
Parp2 | Mus musculus | 10090 | length:559
MAPRRQRSGSGRRVLNEAKKVDNGNKATEDDSPPGKKMRTCQRKGPMAGGKDADRTKDNR
DSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDD
AQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGK
YDMLQMDYAASTQDESKTKEEETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKR
APLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTE
KELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQ
YLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLR
VAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPK
AQGLLRGKHSTKGMGKMAPSPAHFITLNGSTVPLGPASDTGILNPEGYTLNYNEFIVYSP
NQVRMRYLLKIQFNFLQLW
DSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDD
AQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGK
YDMLQMDYAASTQDESKTKEEETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKR
APLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTE
KELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQ
YLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLR
VAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPK
AQGLLRGKHSTKGMGKMAPSPAHFITLNGSTVPLGPASDTGILNPEGYTLNYNEFIVYSP
NQVRMRYLLKIQFNFLQLW
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
PARP2 | orthology | Chimpanzee |
C_intestinalis_ENSCINP00000011691 | orthology | Ciona |
C_intestinalis_ENSCINP00000018492 | orthology | Ciona |
XR_027963.2 | orthology | Cow |
PARP2 | orthology | Dog |
PARP2 | orthology | Fugu |
PARP2 | orthology | Gasterosteus |
PARP2 | orthology | Horse |
PARP2 | orthology | Human |
PARP2 | orthology | Lyzard |
PARP2 | orthology | Macaca |
PARP2 | orthology | Medaka |
PARP2 | orthology | Monodelphis |
PARP2 | orthology | Orangutan |
PARP2 | orthology | Rabbit |
NP_001099500.1 | orthology | Rat |
PARP2 | orthology | Tetraodon |
pme-1 | orthology | Worm |
PARP2 | orthology | Xenopus |
A_aegypti_AAEL011815-PA | paralogy | Aedes |
A_gambiae_AGAP003230-PA | paralogy | Anopheles |
PARP1_CHICK | paralogy | Chicken |
XR_026755.1 | paralogy | Chicken |
PARP4 | paralogy | Chicken |
XR_023240.1 | paralogy | Chimpanzee |
PARP4 | paralogy | Chimpanzee |
PARP3 | paralogy | Chimpanzee |
PARP1_BOVIN | paralogy | Cow |
PARP4 | paralogy | Cow |
XR_028255.2 | paralogy | Cow |
PARP3 | paralogy | Dog |
PARP4 | paralogy | Dog |
PARP1 | paralogy | Dog |
Parp | paralogy | Fly |
PARP3 | paralogy | Fugu |
PARP1 | paralogy | Fugu |
PARP4 | paralogy | Fugu |
PARP4 | paralogy | Gasterosteus |
PARP3 | paralogy | Gasterosteus |
PARP1 | paralogy | Gasterosteus |
PARP3 | paralogy | Gorilla |
PARP1 | paralogy | Gorilla |
PARP3 | paralogy | Horse |
PARP4 | paralogy | Horse |
PARP1 | paralogy | Horse |
PARP1 | paralogy | Human |
PARP3 | paralogy | Human |
PARP4 | paralogy | Human |
PARP4 | paralogy | Lyzard |
PARP3 | paralogy | Lyzard |
PARP1 | paralogy | Lyzard |
PARP3 | paralogy | Macaca |
PARP1 | paralogy | Macaca |
PARP3 | paralogy | Medaka |
PARP1 | paralogy | Medaka |
PARP1 | paralogy | Monodelphis |
PARP4 | paralogy | Monodelphis |
PARP3 | paralogy | Monodelphis |
Parp1 | paralogy | Mouse |
Parp4 | paralogy | Mouse |
Parp3 | paralogy | Mouse |
PARP1 | paralogy | Orangutan |
PARP3 | paralogy | Orangutan |
PARP1 | paralogy | Ornithorhynchus |
PARP1 | paralogy | Rabbit |
PARP4 | paralogy | Rabbit |
Parp1 | paralogy | Rat |
Parp3 | paralogy | Rat |
PARP4 | paralogy | Tetraodon |
PARP3 (1 of 2) | paralogy | Tetraodon |
PARP3 (2 of 2) | paralogy | Tetraodon |
PARP1 | paralogy | Tetraodon |
pme-5 | paralogy | Worm |
pme-2 | paralogy | Worm |
PARP3 | paralogy | Xenopus |
PARP1 | paralogy | Xenopus |
PARP4 | paralogy | Xenopus |
PARP1 | paralogy | Zebra finch |
PARP3 | paralogy | Zebra finch |
parp1 | paralogy | Zebrafish |
parp3 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006284 | base-excision repair | biological_proccess | IMP |
GO:0006471 | protein amino acid ADP-ribosylation | biological_proccess | IEA |
GO:0006281 | DNA repair | biological_proccess | TAS |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003950 | NAD+ ADP-ribosyltransferase activity | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0016757 | transferase activity, transferring glycosyl groups | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005654 | nucleoplasm | cell_component | IDA |
GO:0005730 | nucleolus | cell_component | IDA |
GO:0005730 | nucleolus | cell_component | IEA |
GO:0005654 | nucleoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:1341112
- Ensembl genome browser [?] : ENSMUSG00000036023
- Expression info from Arrayexpress [?] : ENSMUSG00000036023
- Protein expression from Protein Atlas: [?] ENSMUSG00000036023
- Community gene edition from Wikigenes: [?] 11546
Click on [?] for more information.