TNFSF10L3 (Danio rerio)
Description [+]
- Synonyms: TNFSF10L3, TUMOR NECROSIS FACTOR (LIGAND) SUPERFAMILY MEMBER 10 LIKE 3, DL1B, DR_TRAIL-LIKE V1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: tumor necrosis factor (ligand) superfamily, member 10 like 3 [Source:RefSeq_peptide;Acc:NP_001036178]
- Family: Death ligand
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment: Ectopic expression of Tnfsf10l3 in zebrafish embryos induces apoptosis in the notochord and erythroid cells [16888647] . Tnfsf10l3 directly associates with the zebrafish death receptor Hdr [16888647] . Tnfsf10l3-induced apoptosis can be blocked by ectopic expression of zebrafish Cflar or by knockdown of endogenous Hdr or FADD [16888647] . Zebrafish Tnfsf10l3 is more structurally related to Apo2L-like (a second copy of Apo2L/TRAIL found in avian species but not mammals) than to mammalian Apo2L/TRAIL due to additional cysteine residues in its extracellular domain 16888647 .
- WIKI: TNFSF10L3-D_rerio
References [+]
- Delineation of the cell-extrinsic apoptosis pathway in the zebrafish.
- Eimon PM, Kratz E, Varfolomeev E, Hymowitz SG, Stern H, Zha J, Ashkenazi A
- The mammalian extrinsic apoptosis pathway is triggered by Fas ligand (FasL) and Apo2 ligand/tumor necrosis factor (TNF)-related apoptosis-inducing ligand (Apo2L/TRAIL). Ligand binding to cognate receptors activates initiator caspases directly in a death-inducing signaling complex. In Drosophila, TNF ligand binding activates initiator caspases indirectly, through JNK. We characterized the extrinsic pathway in zebrafish to determine how it operates in a nonmammalian vertebrate. We identified homologs of FasL and Apo2L/TRAIL, their receptors, and other components of the cell death machinery. Studies with three Apo2L/TRAIL homologs demonstrated that they bind the receptors zHDR (previously linked to hematopoiesis) and ovarian TNFR (zOTR). Ectopic expression of these ligands during embryogenesis induced apoptosis in erythroblasts and notochord cells. Inhibition of zHDR, zOTR, the adaptor zFADD, or caspase-8-like proteases blocked ligand-induced apoptosis, as did antiapoptotic Bcl-2 family members. Thus, the extrinsic apoptosis pathway in zebrafish closely resembles its mammalian counterpart and cooperates with the intrinsic pathway to trigger tissue-specific apoptosis during embryogenesis in response to ectopic Apo2L/TRAIL expression. Cell Death Differ. 2006 Oct;13(10):1619-30. Epub 2006 Aug 4.
- Early diversification of the TNF superfamily in teleosts: genomic characterization and expression analysis.
- Glenney GW,Wiens GD
- The TNF superfamily (TNFSF) of proteins are cytokines involved in diverse immunological and developmental pathways. Little is known about their evolution or expression in lower vertebrate species. Bioinformatic searches of Zebrafish, Tetraodon, and Fugu genome and other teleost expressed sequence tag databases identified 44 novel gene sequences containing a TNF homology domain. This work reveals the following: 1) teleosts possess orthologs of BAFF, APRIL, EDA, TWEAK, 4-1BBL, Fas ligand, LIGHT, CD40L, RANKL, and possibly TL1A; 2) the BAFF-APRIL subfamily is enriched by a third member, BALM, unique to fish; 3) orthologs of lymphotoxins alpha and beta were not clearly identified in teleosts and are substituted by a related ligand, TNF-New; 4) as many as four TRAIL-like genes are present in teleosts, as compared with only one in mammals; and 5) T cell activation ligands OX40L, CD27L, CD30L, and GITRL were not identified in any fish species. Finally, we characterize mRNA expression of TNFSF members CD40L, LIGHT, BALM, APRIL, Fas ligand, RANKL, TRAIL-like, and TNF-New in rainbow trout, Oncorhynchus mykiss, immune and nonimmune tissues. In conclusion, we identified a total of 14 distinct TNFSF members in fishes, indicating expansion of this superfamily before the divergence of bony fish and tetrapods, approximately 360-450 million years ago. Based on these findings, we extend a model of TNFSF evolution and the co-emergence of the vertebrate adaptive immune system. J Immunol. 2007 Jun 15;178(12):7955-73.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 183 | 313 |
Protein sequence [+]
tnfsf10l3 | Danio rerio | 7955 | length:315
AASEGNSEYLQSVSSESSSFIMVQPKNRLEVPSKMWVTTVVVIVIVLQVASTTGLFIYLN
MSVAQARTQGMVEELRCLGLLNAMEKEQDVPDDLVQLFGEPCIKLAEGLKAYISKVTENI
ISKHTFEERVSFPPRTKLLTTGSPRPSAHLTLRDSGLQEMPQSSTTSLTPQMDLHQSCRH
PVRSWGNQSFGSHLHNMTVSNGRLRVPRAGRYYLYAQVYFRYLTLSVDDYHSGSVSHQVV
QCVYKKTAYARPIQLLKGVGTKCWSPDSENALHSIYQGGLFELRAGDEIFISVSSPTAVY
AEDSSSYFGAFLFDL
MSVAQARTQGMVEELRCLGLLNAMEKEQDVPDDLVQLFGEPCIKLAEGLKAYISKVTENI
ISKHTFEERVSFPPRTKLLTTGSPRPSAHLTLRDSGLQEMPQSSTTSLTPQMDLHQSCRH
PVRSWGNQSFGSHLHNMTVSNGRLRVPRAGRYYLYAQVYFRYLTLSVDDYHSGSVSHQVV
QCVYKKTAYARPIQLLKGVGTKCWSPDSENALHSIYQGGLFELRAGDEIFISVSSPTAVY
AEDSSSYFGAFLFDL
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
NP_989922.1 | orthology | Chicken |
A_carolinensis_ENSACAP00000006055 | orthology | Lyzard |
O_anatinus_ENSOANP00000022049 | orthology | Ornithorhynchus |
TNFSF10 | orthology | Xenopus |
T_guttata_ENSTGUP00000005543 | orthology | Zebra finch |
NP_001019749.1 | paralogy | Chicken |
NP_989710.1 | paralogy | Chicken |
A3RF19_CHICK | paralogy | Chicken |
TNFSF11 | paralogy | Chimpanzee |
TNFSF10 | paralogy | Chimpanzee |
TNFSF15 | paralogy | Chimpanzee |
IPI00690656.3 | paralogy | Cow |
IPI00694513.2 | paralogy | Cow |
IPI00701832.3 | paralogy | Cow |
TNFSF11 | paralogy | Dog |
TNFSF15 | paralogy | Dog |
TNFSF10 | paralogy | Dog |
TNFSF10 (2 of 2) | paralogy | Fugu |
T_rubripes_ENSTRUP00000014307 | paralogy | Fugu |
TNFSF11 | paralogy | Fugu |
TNFSF10 (1 of 2) | paralogy | Fugu |
TNFSF10 | paralogy | Gasterosteus |
TNFSF11 | paralogy | Gorilla |
TNFSF10 | paralogy | Gorilla |
TNFSF15 | paralogy | Gorilla |
TNFSF11 | paralogy | Horse |
TNFSF15 | paralogy | Horse |
TNFSF10 | paralogy | Horse |
TNFSF15 | paralogy | Human |
TNFSF10 | paralogy | Human |
TNFSF11 | paralogy | Human |
TNFSF15 | paralogy | Lyzard |
A_carolinensis_ENSACAP00000001868 | paralogy | Lyzard |
TNFSF10 | paralogy | Lyzard |
TNFSF15 | paralogy | Macaca |
TNFSF11 | paralogy | Macaca |
TNFSF10 | paralogy | Macaca |
TNFSF10 (2 of 2) | paralogy | Medaka |
O_latipes_ENSORLP00000010677 | paralogy | Medaka |
TNFSF10 (1 of 2) | paralogy | Medaka |
TNFSF14 | paralogy | Monodelphis |
TNFSF10 | paralogy | Monodelphis |
TNFSF15 | paralogy | Monodelphis |
CD40LG | paralogy | Monodelphis |
M_domestica_ENSMODP00000036348 | paralogy | Monodelphis |
TRAIL | paralogy | Mouse |
Tnfsf11 | paralogy | Mouse |
Tnfsf15 | paralogy | Mouse |
TNFSF10 | paralogy | Orangutan |
TNFSF15 | paralogy | Orangutan |
TNFSF11 | paralogy | Orangutan |
TNFSF15 | paralogy | Ornithorhynchus |
CD40LG | paralogy | Ornithorhynchus |
O_anatinus_ENSOANP00000007357 | paralogy | Ornithorhynchus |
TNFSF10 | paralogy | Ornithorhynchus |
FASLG | paralogy | Ornithorhynchus |
O_cuniculus_ENSOCUP00000012761 | paralogy | Rabbit |
TNFSF11 | paralogy | Rabbit |
TNFSF15 | paralogy | Rabbit |
O_cuniculus_ENSOCUP00000004879 | paralogy | Rabbit |
Tnfsf10 | paralogy | Rat |
Tnfsf15 | paralogy | Rat |
Tnfsf11 | paralogy | Rat |
TNFSF11 | paralogy | Tetraodon |
TNFSF10 (2 of 2) | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000008505 | paralogy | Tetraodon |
TNFSF10 (1 of 2) | paralogy | Tetraodon |
X_tropicalis_ENSXETP00000054163 | paralogy | Xenopus |
TNFSF15 | paralogy | Xenopus |
CD40LG | paralogy | Xenopus |
TNFSF15 | paralogy | Zebra finch |
CD40LG | paralogy | Zebra finch |
T_guttata_ENSTGUP00000012735 | paralogy | Zebra finch |
TNFSF10 | paralogy | Zebra finch |
tnfsf10l4 | paralogy | Zebrafish |
tnfsf10l2 | paralogy | Zebrafish |
tnfsf10l | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-070606-1
- Ensembl genome browser [?] : ENSDARG00000032746
- Expression info from Arrayexpress [?] : ENSDARG00000032746
- Protein expression from Protein Atlas: [?] ENSDARG00000032746
- Community gene edition from Wikigenes: [?] 562262
- entrezgene: 562262
- refseq_dna: NM_001042713
- refseq_peptide: NP_001036178
Click on [?] for more information.