CASP4 (Homo sapiens)
Description [+]
- Synonyms: CASP4, ICE(REL)II, ICH-2, TX
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Caspase-4 Precursor (CASP-4)(EC 3.4.22.57)(ICH-2 protease)(TX protease)(ICE(rel)-II) [Contains Caspase-4 subunit 1;Caspase-4 subunit 2] [Source:UniProtKB/Swiss-Prot;Acc:P49662]
- Family: CASPASE
- Process: immunity,
- Pathways:
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Casp4
- WIKI: CASP4-H_sapiens
References [+]
- A novel human protease similar to the interleukin-1 beta converting enzyme induces apoptosis in transfected cells.
- Faucheu C, Diu A, Chan AW, Blanchet AM, Miossec C, Herve F, Collard-Dutilleul V, Gu Y, Aldape RA, Lippke JA, et al.
- We have identified a novel cDNA encoding a protein (named TX) with > 50% overall sequence identity with the interleukin-1 beta converting enzyme (ICE) and approximately 30% sequence identity with the ICE homologs NEDD-2/ICH-1L and CED-3. A computer homology model of TX was constructed based on the X-ray coordinates of the ICE crystal recently published. This model suggests that TX is a cysteine protease, with the P1 aspartic acid substrate specificity retained. Transfection experiments demonstrate that TX is a protease which is able to cleave itself and the p30 ICE precursor, but not to generate mature IL-1 beta from pro-IL-1 beta. In addition, this protein induces apoptosis in transfected COS cells. TX therefore delineates a new member of the growing Ice/ced-3 gene family coding for proteases with cytokine processing activity or involved in programmed cell death. EMBO J. 1995 May 1;14(9):1914-22.
- Involvement of caspase-4 in endoplasmic reticulum stress-induced apoptosis and Abeta-induced cell death.
- Hitomi J, Katayama T, Eguchi Y, Kudo T, Taniguchi M, Koyama Y, Manabe T, Yamagishi S, Bando Y, Imaizumi K, Tsujimoto Y, Tohyama M
- Recent studies have suggested that neuronal death in Alzheimer's disease or ischemia could arise from dysfunction of the endoplasmic reticulum (ER). Although caspase-12 has been implicated in ER stress-induced apoptosis and amyloid-beta (Abeta)-induced apoptosis in rodents, it is controversial whether similar mechanisms operate in humans. We found that human caspase-4, a member of caspase-1 subfamily that includes caspase-12, is localized to the ER membrane, and is cleaved when cells are treated with ER stress-inducing reagents, but not with other apoptotic reagents. Cleavage of caspase-4 is not affected by overexpression of Bcl-2, which prevents signal transduction on the mitochondria, suggesting that caspase-4 is primarily activated in ER stress-induced apoptosis. Furthermore, a reduction of caspase-4 expression by small interfering RNA decreases ER stress-induced apoptosis in some cell lines, but not other ER stress-independent apoptosis. Caspase-4 is also cleaved by administration of Abeta, and Abeta-induced apoptosis is reduced by small interfering RNAs to caspase-4. Thus, caspase-4 can function as an ER stress-specific caspase in humans, and may be involved in pathogenesis of Alzheimer's disease. J Cell Biol. 2004 May 10;165(3):347-56. Epub 2004 May 3.
- References from Mouse ortholog(s):
- Murine caspase-11, an ICE-interacting protease, is essential for the activation of ICE.
- Wang S, Miura M, Jung YK, Zhu H, Li E, Yuan J
- We report here the inactivation of a member of the Ice/Ced-3 (caspase) family of cell death genes, casp-11, by gene targeting. Like Ice-deficient mice, casp-11 mutant mice are resistant to endotoxic shock induced by lipopolysaccharide. Production of both IL-1alpha and IL-1beta after lipopolysaccharide stimulation, a crucial event during septic shock and an indication of ICE activation, is blocked in casp-11 mutant mice. casp-11 mutant embryonic fibroblast cells are resistant to apoptosis induced by overexpression of ICE. Furthermore, we found that pro-caspase-11 physically interacts with pro-ICE in cells, and the expression of casp-11 is essential for activation of ICE. Our data suggest that caspase-11 is a component of ICE complex and is required for the activation of ICE. Cell. 1998 Feb 20;92(4):501-9.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | CARD | 3 | 90 |
| PFAM A | Peptidase_C14 | 136 | 373 |
Protein sequence [+]
CASP4 | Homo sapiens | 9606 | length:377
MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
MQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
TIERLSMTRYFYLFPGN
MQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
TIERLSMTRYFYLFPGN
Structure links:
- Smartdomain prediction information: SM00114
- Smartdomain prediction information: SM00115
- Prosite motif and domain information: PS01121
- Prosite motif and domain information: PS01122
- Profile motif and domain profile information: PS50209
- Profile motif and domain profile information: PS50207
- Profile motif and domain profile information: PS50208
- Interpro domain information: P49662
- PFAM domain and domain family information: P49662
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| NP_990255.1 | orthology | Chicken |
| CASP4 | orthology | Chimpanzee |
| CASPD_BOVIN | orthology | Cow |
| CASP1_CANFA | orthology | Dog |
| T_rubripes_ENSTRUP00000013027 | orthology | Fugu |
| T_rubripes_ENSTRUP00000019853 | orthology | Fugu |
| T_rubripes_ENSTRUP00000035020 | orthology | Fugu |
| CASP12 | orthology | Gasterosteus |
| CASP4 | orthology | Horse |
| A_carolinensis_ENSACAP00000013361 | orthology | Lyzard |
| CASP4 | orthology | Macaca |
| CASP12 | orthology | Medaka |
| Casp4 | orthology | Mouse |
| CASP4 | orthology | Orangutan |
| CASP4 | orthology | Rabbit |
| Casp4 | orthology | Rat |
| X_tropicalis_ENSXETP00000017024 | orthology | Xenopus |
| LOC566185 | orthology | Zebrafish |
| caspb | orthology | Zebrafish |
| caspa | orthology | Zebrafish |
| A_aegypti_AAEL003444-PA | paralogy | Aedes |
| A_aegypti_AAEL014348-PA | paralogy | Aedes |
| CASPS7 | paralogy | Anopheles |
| CASPS6 | paralogy | Anopheles |
| CASPS8 | paralogy | Anopheles |
| CASPS4 | paralogy | Anopheles |
| Q90WU0_CHICK | paralogy | Chicken |
| CASP7 | paralogy | Chicken |
| NP_990056.1 | paralogy | Chicken |
| CASP2_CHICK | paralogy | Chicken |
| XR_019722.1 | paralogy | Chimpanzee |
| CASP2 | paralogy | Chimpanzee |
| CASP12 | paralogy | Chimpanzee |
| CASP3_PANTR | paralogy | Chimpanzee |
| CASP9 | paralogy | Chimpanzee |
| CASP1 | paralogy | Chimpanzee |
| C_intestinalis_ENSCINP00000002956 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000024485 | paralogy | Ciona |
| IPI00704513.4 | paralogy | Cow |
| IPI00689801.3 | paralogy | Cow |
| NP_001029681.1 | paralogy | Cow |
| CASP3_BOVIN | paralogy | Cow |
| IPI00707783.1 | paralogy | Cow |
| A0PCH9_BOVIN | paralogy | Cow |
| IPI00688117.2 | paralogy | Cow |
| CASP2 | paralogy | Dog |
| CASP12 | paralogy | Dog |
| CASP14 | paralogy | Dog |
| Q45T68_CANFA | paralogy | Dog |
| CASP3_CANFA | paralogy | Dog |
| Dcp-1 | paralogy | Fly |
| Ice | paralogy | Fly |
| CASP7 | paralogy | Fugu |
| NP_001027871.1 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000044662 | paralogy | Fugu |
| CASP9 | paralogy | Fugu |
| CASP9 | paralogy | Gasterosteus |
| CASP7 | paralogy | Gasterosteus |
| CASP2 | paralogy | Gasterosteus |
| CASP3 (4 of 4) | paralogy | Gasterosteus |
| CASP3 (3 of 4) | paralogy | Gasterosteus |
| CASP3 (2 of 4) | paralogy | Gasterosteus |
| CASP3 (1 of 4) | paralogy | Gasterosteus |
| CASP5 | paralogy | Gorilla |
| CASP12 | paralogy | Gorilla |
| CASP2 | paralogy | Horse |
| CASP12 | paralogy | Horse |
| CASP14 | paralogy | Horse |
| CASP7 | paralogy | Horse |
| CASP9 | paralogy | Horse |
| Q3S2Z5_HORSE | paralogy | Horse |
| CASP1_HORSE | paralogy | Horse |
| Caspase-14 | paralogy | Human |
| CASP1 | paralogy | Human |
| CASP3 | paralogy | Human |
| CASP2 | paralogy | Human |
| CASP12 | paralogy | Human |
| CASP9 | paralogy | Human |
| CASP5 | paralogy | Human |
| CASP3 | paralogy | Lyzard |
| CASP2 | paralogy | Lyzard |
| CASP7 | paralogy | Lyzard |
| CASP14 | paralogy | Lyzard |
| CASP5 | paralogy | Macaca |
| CASP1 | paralogy | Macaca |
| Q8SPU2_MACMU | paralogy | Macaca |
| Q8SPP8_MACMU | paralogy | Macaca |
| CASP12 | paralogy | Macaca |
| CASP9 | paralogy | Macaca |
| CASP9 | paralogy | Medaka |
| Q8JIS9_ORYLA | paralogy | Medaka |
| Q8JIS8_ORYLA | paralogy | Medaka |
| CASP2 | paralogy | Medaka |
| CASP2 | paralogy | Monodelphis |
| CASP9 | paralogy | Monodelphis |
| NP_001033059.1 | paralogy | Monodelphis |
| NP_001033061.1 | paralogy | Monodelphis |
| CASP14 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000034020 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000034022 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000034033 | paralogy | Monodelphis |
| CASP8 | paralogy | Monodelphis |
| Casp7 | paralogy | Mouse |
| Casp12 | paralogy | Mouse |
| Casp1 | paralogy | Mouse |
| Casp9 | paralogy | Mouse |
| Casp2 | paralogy | Mouse |
| Casp3 | paralogy | Mouse |
| CASP9 | paralogy | Orangutan |
| CASP12 | paralogy | Orangutan |
| CASP5 | paralogy | Orangutan |
| CASP1 | paralogy | Orangutan |
| CASP3 | paralogy | Orangutan |
| CASP2 | paralogy | Orangutan |
| CASP2 | paralogy | Ornithorhynchus |
| CASP9 | paralogy | Ornithorhynchus |
| O_anatinus_ENSOANP00000016591 | paralogy | Ornithorhynchus |
| O_anatinus_ENSOANP00000019254 | paralogy | Ornithorhynchus |
| CASP3 | paralogy | Ornithorhynchus |
| CASP1 | paralogy | Rabbit |
| CASP14 | paralogy | Rabbit |
| Casp1 | paralogy | Rat |
| Casp3 | paralogy | Rat |
| Casp9 | paralogy | Rat |
| Casp2 | paralogy | Rat |
| Casp12 | paralogy | Rat |
| CASP3 | paralogy | Tetraodon |
| CASP2 | paralogy | Tetraodon |
| CASP7 | paralogy | Tetraodon |
| ced-3 | paralogy | Worm |
| CASP3 | paralogy | Xenopus |
| CASP2 | paralogy | Xenopus |
| casp7 | paralogy | Xenopus |
| CASP3 | paralogy | Zebra finch |
| CASP8 | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000011206 | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000013612 | paralogy | Zebra finch |
| CASP9 | paralogy | Zebra finch |
| D_rerio_ENSDARP00000047019 | paralogy | Zebrafish |
| NP_001077331.1 | paralogy | Zebrafish |
| casp3b | paralogy | Zebrafish |
| LOC100000522 | paralogy | Zebrafish |
| A2BGE2_DANRE | paralogy | Zebrafish |
| casp8l1 | paralogy | Zebrafish |
| LOC795066 | paralogy | Zebrafish |
| casp2 | paralogy | Zebrafish |
| casp3a | paralogy | Zebrafish |
| LOC563034 | paralogy | Zebrafish |
| casp7 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0006917 | induction of apoptosis | biological_proccess | TAS |
| GO:0006508 | proteolysis | biological_proccess | TAS |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0006508 | proteolysis | biological_proccess | IEA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
| GO:0008233 | peptidase activity | mollecular_function | IEA |
| GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :1505
- Gene related info from GeneCards [?] : CASP4
- Ensembl genome browser [?] : ENSG00000196954
- Expression info from Arrayexpress [?] : ENSG00000196954
- Protein expression from Protein Atlas: [?] ENSG00000196954
- Community gene edition from Wikigenes: [?] 837
- OMIM gene information: 602664
- OMIM disease information:
Click on [?] for more information.
