FAS (Homo sapiens)
Description [+]
- Synonyms: FAS, CD95, APO-1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor receptor superfamily member 6 Precursor (FASLG receptor)(Apoptosis-mediating surface antigen FAS)(Apo-1 antigen)(CD95 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P25445]
- Family: death receptor
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Fas
- WIKI: FAS-H_sapiens
References [+]
- The polypeptide encoded by the cDNA for human cell surface antigen Fas can mediate apoptosis.
- Itoh N, Yonehara S, Ishii A, Yonehara M, Mizushima S, Sameshima M, Hase A, Seto Y, Nagata S
- Mouse anti-Fas monoclonal antibody has a cytolytic activity on human cells that express the antigen. Complementary DNAs encoding the cell surface antigen Fas were isolated from a cDNA library of human T cell lymphoma KT-3 cells. The nucleotide sequence of the cDNAs revealed that the molecule coding for the Fas antigen determinant is a 319 amino acid polypeptide (Mr 36,000) with a single transmembrane domain. The extracellular domain is rich in cysteine residue, and shows a similarity to that of human tumor necrosis factor receptors, human nerve growth factor receptor, and human B cell antigen CD40. Murine WR19L cells or L929 cells transformed with the human Fas antigen cDNA were killed by the anti-Fas antibody in the process known as apoptosis. Cell. 1991 Jul 26;66(2):233-43.
- References from Mouse ortholog(s):
- Lymphoproliferation disorder in mice explained by defects in Fas antigen that mediates apoptosis.
- Watanabe-Fukunaga R, Brannan CI, Copeland NG, Jenkins NA, Nagata S
- Fas antigen is a cell-surface protein that mediates apoptosis. It is expressed in various tissues including the thymus and has structural homology with a number of cell-surface receptors, including tumour necrosis factor receptor and nerve growth factor receptor. Mice carrying the lymphoproliferation (lpr) mutation have defects in the Fas antigen gene. The lpr mice develop lymphadenopathy and suffer from a systemic lupus erythematosus-like autoimmune disease, indicating an important role for Fas antigen in the negative selection of autoreactive T cells in the thymus. Nature. 1992 Mar 26;356(6367):314-7.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNFR_c6 | 112 | 154 |
| PFAM A | TNFR_c6 | 156 | 192 |
| PFAM A | Death | 258 | 341 |
Protein sequence [+]
FAS | Homo sapiens | 9606 | length:362
MLRVCAQGWHAQGLPHGTNSLLKGGTETSLSTPTRLVVLTSVARLSSKSVNAQVTDINSK
GLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTD
KAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGI
IKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESP
TLNPVGIEIDFSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQ
KVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQS
LV
GLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTD
KAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGI
IKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESP
TLNPVGIEIDFSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQ
KVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQS
LV
Structure links:
- Smartdomain prediction information: SM00208
- Smartdomain prediction information: SM00005
- Prosite motif and domain information: PS00652
- Profile motif and domain profile information: PS50311
- Profile motif and domain profile information: PS50017
- Profile motif and domain profile information: PS50050
- Interpro domain information: P25445
- PFAM domain and domain family information: P25445
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| Q9DGH7_CHICK | orthology | Chicken |
| FAS | orthology | Chimpanzee |
| TNR6_BOVIN | orthology | Cow |
| FAS | orthology | Dog |
| FAS | orthology | Horse |
| TNR6_MACMU | orthology | Macaca |
| Q56VC6_ORYLA | orthology | Medaka |
| Fas | orthology | Mouse |
| FAS | orthology | Orangutan |
| FAS | orthology | Rabbit |
| Fas | orthology | Rat |
| T_guttata_ENSTGUP00000017300 | orthology | Zebra finch |
| T_guttata_ENSTGUP00000008561 | orthology | Zebra finch |
| fas | orthology | Zebrafish |
| NP_001025950.1 | paralogy | Chicken |
| LTBR | paralogy | Chimpanzee |
| TNFRSF10B | paralogy | Chimpanzee |
| TNFRSF11B | paralogy | Chimpanzee |
| TNFRSF10A | paralogy | Chimpanzee |
| TNFRSF10C | paralogy | Chimpanzee |
| NP_001091525.1 | paralogy | Cow |
| NGFR (2 of 2) | paralogy | Fugu |
| T_rubripes_ENSTRUP00000010129 | paralogy | Fugu |
| G_aculeatus_ENSGACP00000007142 | paralogy | Gasterosteus |
| NGFR (1 of 2) | paralogy | Gasterosteus |
| TNFRSF1B | paralogy | Gasterosteus |
| TNFRSF10A | paralogy | Gorilla |
| LTBR | paralogy | Gorilla |
| TNFRSF11B | paralogy | Horse |
| LTBR | paralogy | Human |
| TRAIL-R3 / TNFSF10C | paralogy | Human |
| TNFRSF14 | paralogy | Human |
| TRAIL-R1, DR4 | paralogy | Human |
| TNFRSF11B | paralogy | Human |
| TNFRSF14 | paralogy | Macaca |
| TNFRSF10A | paralogy | Macaca |
| TNFRSF11B | paralogy | Macaca |
| NGFR (2 of 2) | paralogy | Medaka |
| TNFRSF1B | paralogy | Medaka |
| O_latipes_ENSORLP00000020293 | paralogy | Medaka |
| Tnfrsf22 | paralogy | Mouse |
| Tnfrsf10b | paralogy | Mouse |
| M_musculus_ENSMUSP00000078705 | paralogy | Mouse |
| Tnfrsf23 | paralogy | Mouse |
| Cd40 | paralogy | Mouse |
| TNFRSF10A | paralogy | Orangutan |
| TNFRSF11B | paralogy | Orangutan |
| O_anatinus_ENSOANP00000021880 | paralogy | Ornithorhynchus |
| TNFRSF11B | paralogy | Rabbit |
| Tnfrsf5 | paralogy | Rat |
| Tnfrsf11b | paralogy | Rat |
| TNFRSF1B | paralogy | Tetraodon |
| TNFRSF10D | paralogy | Tetraodon |
| BC075302.1 | paralogy | Xenopus |
| TNFRSF1A | paralogy | Zebra finch |
| hdr | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0006955 | immune response | biological_proccess | IEA |
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0007568 | aging | biological_proccess | IEA |
| GO:0043434 | response to peptide hormone stimulus | biological_proccess | IEA |
| GO:0001666 | response to hypoxia | biological_proccess | IEA |
| GO:0010035 | response to inorganic substance | biological_proccess | IEA |
| GO:0042493 | response to drug | biological_proccess | IEA |
| GO:0009636 | response to toxin | biological_proccess | IEA |
| GO:0043627 | response to estrogen stimulus | biological_proccess | IEA |
| GO:0007283 | spermatogenesis | biological_proccess | IEA |
| GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
| GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
| GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
| GO:0042698 | ovulation cycle | biological_proccess | IEA |
| GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
| GO:0048536 | spleen development | biological_proccess | IEA |
| GO:0045619 | regulation of lymphocyte differentiation | biological_proccess | IEA |
| GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
| GO:0051260 | protein homooligomerization | biological_proccess | IEA |
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
| GO:0043029 | T cell homeostasis | biological_proccess | IEA |
| GO:0051789 | response to protein stimulus | biological_proccess | IEA |
| GO:0006924 | activation-induced cell death of T cells | biological_proccess | IEA |
| GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
| GO:0006925 | inflammatory cell apoptosis | biological_proccess | IEA |
| GO:0045060 | negative thymic T cell selection | biological_proccess | IEA |
| GO:0006927 | transformed cell apoptosis | biological_proccess | IEA |
| GO:0010467 | gene expression | biological_proccess | IEA |
| GO:0002377 | immunoglobulin production | biological_proccess | IEA |
| GO:0003014 | renal system process | biological_proccess | IEA |
| GO:0019724 | B cell mediated immunity | biological_proccess | IEA |
| GO:0045637 | regulation of myeloid cell differentiation | biological_proccess | IEA |
| GO:0050869 | negative regulation of B cell activation | biological_proccess | IEA |
| GO:0010940 | positive regulation of necrotic cell death | biological_proccess | IMP |
| GO:0006461 | protein complex assembly | biological_proccess | TAS |
| GO:0006916 | anti-apoptosis | biological_proccess | TAS |
| GO:0007165 | signal transduction | biological_proccess | TAS |
| GO:0008633 | activation of pro-apoptotic gene products | biological_proccess | EXP |
| GO:0004872 | receptor activity | mollecular_function | IEA |
| GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0042802 | identical protein binding | mollecular_function | IPI |
| GO:0019900 | kinase binding | mollecular_function | IPI |
| GO:0016020 | membrane | cell_component | IEA |
| GO:0005901 | caveola | cell_component | IEA |
| GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
| GO:0005576 | extracellular region | cell_component | IEA |
| GO:0009986 | cell surface | cell_component | IEA |
| GO:0009897 | external side of plasma membrane | cell_component | IEA |
| GO:0031264 | death-inducing signaling complex | cell_component | IDA |
| GO:0005625 | soluble fraction | cell_component | TAS |
| GO:0005886 | plasma membrane | cell_component | EXP |
| GO:0016021 | integral to membrane | cell_component | IEA |
| GO:0005829 | cytosol | cell_component | NAS |
Check GO Evidence Codes here
miRNAs [+]
| miRNA | Regulation | Description | Pubmed |
|---|---|---|---|
| hsa-miR-21 | downregulation by LNA antisense miRNA oligonucleot | All 18 genes showed, to varying degrees, increased mRNA expression levels upon miR-21 inhibition (Fig. 2B). | Ref. |
| hsa-miR-21 | downregulation by LNA antisense miRNA oligonucleot | Following normalization and statistical analysis we found 737 transcripts with significantly different expression between the LNA-miR-21-transfected cells and the controls, of which 402 (55%) were up-regulated and 335 (45%) down-regulated upon miR-21 inhibition (Fig. 2A and supplemental Table S1). | Ref. |
Curated Isoforms [+]
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :11920
- Gene related info from GeneCards [?] : FAS
- Ensembl genome browser [?] : ENSG00000026103
- Expression info from Arrayexpress [?] : ENSG00000026103
- Protein expression from Protein Atlas: [?] ENSG00000026103
- Community gene edition from Wikigenes: [?] 355
- entrezgene: 355
- refseq_dna: NM_152871
- refseq_dna: NM_152874
- refseq_dna: NM_152873
- refseq_dna: NM_152877
- refseq_dna: NM_152875
- refseq_dna: NM_152876
- refseq_dna: NM_152872
- refseq_dna: NM_000043
- refseq_peptide: NP_690610
- refseq_peptide: NP_690614
- refseq_peptide: NP_690613
- refseq_peptide: NP_690612
- refseq_peptide: NP_690616
- refseq_peptide: NP_690615
- refseq_peptide: NP_690611
- refseq_peptide: NP_000034
Click on [?] for more information.
