BAK1 (Mus musculus)
Description [+]
- Synonyms: BAK1, BCL2-ANTAGONIST/KILLER 1, BAK, N-BAK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: BCL2-antagonist/killer 1 Gene [Source:MGI (curated);Acc:Bak1-001]
- Family: Bcl-2 family : multidomain Bcl-2
- Process: apoptosis,
- Pathways: intrinsic pathway, pre-mitochondrial signaling events,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): BAK1
- WIKI: BAK1-M_musculus
References [+]
- Proapoptotic BAX and BAK: a requisite gateway to mitochondrial dysfunction and death.
- Wei MC, Zong WX, Cheng EH, Lindsten T, Panoutsakopoulou V, Ross AJ, Roth KA, MacGregor GR, Thompson CB, Korsmeyer SJ
- Multiple death signals influence mitochondria during apoptosis, yet the critical initiating event for mitochondrial dysfunction in vivo has been unclear. tBID, the caspase-activated form of a "BH3-domain-only" BCL-2 family member, triggers the homooligomerization of "multidomain" conserved proapoptotic family members BAK or BAX, resulting in the release of cytochrome c from mitochondria. We find that cells lacking both Bax and Bak, but not cells lacking only one of these components, are completely resistant to tBID-induced cytochrome c release and apoptosis. Moreover, doubly deficient cells are resistant to multiple apoptotic stimuli that act through disruption of mitochondrial function: staurosporine, ultraviolet radiation, growth factor deprivation, etoposide, and the endoplasmic reticulum stress stimuli thapsigargin and tunicamycin. Thus, activation of a "multidomain" proapoptotic member, BAX or BAK, appears to be an essential gateway to mitochondrial dysfunction required for cell death in response to diverse stimuli. Science. 2001 Apr 27;292(5517):727-30.
- Gene structure, cDNA sequence, and expression of murine Bak, a proapoptotic Bcl-2 family member.
- Ulrich E, Kauffmann-Zeh A, Hueber AO, Williamson J, Chittenden T, Ma A, Evan G
- To facilitate the creation of Bak knockout mice and the further analysis of this Bcl-2 family member, we have isolated and sequenced the complete mouse Bak cDNA. The cDNA is 2 kb long and shares an overall nucleotide identity to the human Bak cDNA of 62%. The mouse Bak protein is 208 amino acids long with a predicted molecular weight of 23 kDa. The mouse Bak mRNA could be detected in all mouse tissues examined. In addition we mapped the murine bak gene. It consists of six exons spanning about 10 kb on chromosome 17B. The 5' region of the murine bak gene is unmethylated on the dinucleotide CpG in the area around exon 1. Furthermore, it contains potential binding sites for transcription factors such as Sp1 and c-Myb. Genomics. 1997 Sep 1;44(2):195-200.
- References from Human ortholog(s):
- Induction of apoptosis by the Bcl-2 homologue Bak.
- Chittenden T, Harrington EA, O'Connor R, Flemington C, Lutz RJ, Evan GI, Guild BC
- Cells are eliminated in a variety of physiological settings by apoptosis, a genetically encoded process of cellular suicide. Apoptosis comprises an intrinsic cellular defence against tumorigenesis, which, when suppressed, may contribute to the development of malignancies. The bcl-2 oncogene, which is activated in follicular lymphomas, functions as a potent suppressor of apoptosis under diverse conditions. Here we describe the complementary DNA cloning and functional analysis of a new Bcl-2 homologue, Bak, which promotes cell death and counteracts the protection from apoptosis provided by Bcl-2. Moreover, enforced expression of Bak induces rapid and extensive apoptosis of serum-deprived fibroblasts. This raises the possibility that Bak is directly involved in activating the cell death machinery. Nature. 1995 Apr 20;374(6524):733-6.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Bcl-2 | 76 | 175 |
Protein sequence [+]
Bak1 | Mus musculus | 10090 | length:209
MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDN
LPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSG
ISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALN
FRRDPILTVMVIFGVVLLGQFVVHRFFRS
LPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSG
ISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALN
FRRDPILTVMVIFGVVLLGQFVVHRFFRS
Structure links:
- Smartdomain prediction information: SM00337
- Prosite motif and domain information: PS01259
- Prosite motif and domain information: PS01080
- Prosite motif and domain information: PS01258
- Interpro domain information: O08734
- PFAM domain and domain family information: O08734
- Protein 3D structures from PDB: 2VOH
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| NP_001026091.1 | orthology | Chicken |
| XR_024448.1 | orthology | Chimpanzee |
| NP_001071386.1 | orthology | Cow |
| NP_001018644.1 | orthology | Dog |
| BAK1 | orthology | Gorilla |
| BAK1 | orthology | Horse |
| BAK1 | orthology | Human |
| BAK1 | orthology | Lyzard |
| BAK1 | orthology | Macaca |
| BAK1 | orthology | Monodelphis |
| P_pygmaeus_ENSPPYP00000006150 | orthology | Orangutan |
| P_pygmaeus_ENSPPYP00000018457 | orthology | Orangutan |
| BAK1 | orthology | Rabbit |
| Bak1 | orthology | Rat |
| BAK1 | orthology | Xenopus |
| BAK1 | orthology | Zebra finch |
| A_aegypti_AAEL001521-PA | paralogy | Aedes |
| Q2PHG8_ANOGA | paralogy | Anopheles |
| BOK_CHICK | paralogy | Chicken |
| BCLX_CHICK | paralogy | Chicken |
| BCL2_CHICK | paralogy | Chicken |
| BCL2L2 | paralogy | Chimpanzee |
| BCL2 | paralogy | Chimpanzee |
| BAX | paralogy | Chimpanzee |
| BCL2L1 | paralogy | Chimpanzee |
| C_intestinalis_ENSCINP00000024813 | paralogy | Ciona |
| NP_001070954.1 | paralogy | Cow |
| NP_001092338.1 | paralogy | Cow |
| BAX_BOVIN | paralogy | Cow |
| Q462R3_BOVIN | paralogy | Cow |
| BCLW_BOVIN | paralogy | Cow |
| NP_001003072.1 | paralogy | Dog |
| BCL2 | paralogy | Dog |
| T_rubripes_ENSTRUP00000006891 | paralogy | Fugu |
| BCL2 | paralogy | Fugu |
| BCL2L1 (1 of 6) | paralogy | Fugu |
| BCL2L1 (2 of 6) | paralogy | Fugu |
| BAX | paralogy | Fugu |
| BCL2L1 (1 of 2) | paralogy | Gasterosteus |
| BOK (1 of 2) | paralogy | Gasterosteus |
| BCL2L1 (2 of 2) | paralogy | Gasterosteus |
| BCL2 | paralogy | Gasterosteus |
| BOK (2 of 2) | paralogy | Gasterosteus |
| BAX | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000018978 | paralogy | Gasterosteus |
| BCL2 | paralogy | Gorilla |
| BCL2L2 | paralogy | Gorilla |
| BOK | paralogy | Gorilla |
| BCL2L2 | paralogy | Horse |
| BCL2L1 | paralogy | Horse |
| BCL2 | paralogy | Horse |
| BCL2L2 | paralogy | Human |
| BAX | paralogy | Human |
| BOK | paralogy | Human |
| BCL2L1 | paralogy | Human |
| BCL2 | paralogy | Human |
| BOK | paralogy | Lyzard |
| A_carolinensis_ENSACAP00000004550 | paralogy | Lyzard |
| BCL2L1 | paralogy | Lyzard |
| BAX | paralogy | Lyzard |
| BCL2 | paralogy | Lyzard |
| BAX | paralogy | Macaca |
| BOK | paralogy | Macaca |
| BCL2L1 | paralogy | Macaca |
| BCL2 | paralogy | Macaca |
| BCL2L2 | paralogy | Macaca |
| BCL2L1 | paralogy | Medaka |
| BCL2 | paralogy | Medaka |
| BCL2 | paralogy | Monodelphis |
| BAX | paralogy | Monodelphis |
| BOK | paralogy | Monodelphis |
| BCL2L1 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000005598 | paralogy | Monodelphis |
| Bcl2l2 | paralogy | Mouse |
| Bok | paralogy | Mouse |
| Bax | paralogy | Mouse |
| Mcl1 | paralogy | Mouse |
| Bcl2l1 | paralogy | Mouse |
| Bcl2 | paralogy | Mouse |
| BCL2 | paralogy | Orangutan |
| BCL2L1 | paralogy | Orangutan |
| BOK | paralogy | Orangutan |
| BOK | paralogy | Ornithorhynchus |
| BCL2L2 | paralogy | Ornithorhynchus |
| Q9MYW4_RABIT | paralogy | Rabbit |
| Bcl2 | paralogy | Rat |
| Bok | paralogy | Rat |
| Bax | paralogy | Rat |
| BCLX_RAT | paralogy | Rat |
| RGD1565822_predicted | paralogy | Rat |
| BCL2 | paralogy | Tetraodon |
| BOK (1 of 2) | paralogy | Tetraodon |
| BCL2L1 (1 of 3) | paralogy | Tetraodon |
| BCL2L1 (2 of 3) | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000017211 | paralogy | Tetraodon |
| BOK (2 of 2) | paralogy | Tetraodon |
| bcl2l2 | paralogy | Xenopus |
| BCL2 | paralogy | Xenopus |
| BCL2L1 | paralogy | Xenopus |
| BCL2 | paralogy | Zebra finch |
| BOK | paralogy | Zebra finch |
| BCL2L1 | paralogy | Zebra finch |
| BAX | paralogy | Zebra finch |
| baxa | paralogy | Zebrafish |
| zgc:153993 | paralogy | Zebrafish |
| bcl2l | paralogy | Zebrafish |
| bcl2 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0001782 | B cell homeostasis | biological_proccess | IMP |
| GO:0001783 | B cell apoptosis | biological_proccess | IGI |
| GO:0001974 | blood vessel remodeling | biological_proccess | IGI |
| GO:0002262 | myeloid cell homeostasis | biological_proccess | IGI |
| GO:0002352 | B cell negative selection | biological_proccess | IGI |
| GO:0008053 | mitochondrial fusion | biological_proccess | IGI |
| GO:0008283 | cell proliferation | biological_proccess | IDA |
| GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IMP |
| GO:0009620 | response to fungus | biological_proccess | IMP |
| GO:0010046 | response to mycotoxin | biological_proccess | IMP |
| GO:0010332 | response to gamma radiation | biological_proccess | IMP |
| GO:0010524 | positive regulation of calcium ion transport into cytosol | biological_proccess | IGI |
| GO:0032471 | reduction of endoplasmic reticulum calcium ion concentration | biological_proccess | IGI |
| GO:0033137 | negative regulation of peptidyl-serine phosphorylation | biological_proccess | IGI |
| GO:0035108 | limb morphogenesis | biological_proccess | IGI |
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IMP |
| GO:0048597 | post-embryonic camera-type eye morphogenesis | biological_proccess | IGI |
| GO:0051726 | regulation of cell cycle | biological_proccess | IGI |
| GO:0060068 | vagina development | biological_proccess | IGI |
| GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IGI |
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0001776 | leukocyte homeostasis | biological_proccess | IGI |
| GO:0006915 | apoptosis | biological_proccess | RCA |
| GO:0042981 | regulation of apoptosis | biological_proccess | RCA |
| GO:0006919 | activation of caspase activity | biological_proccess | IGI |
| GO:0048872 | homeostasis of number of cells | biological_proccess | IGI |
| GO:0046872 | metal ion binding | mollecular_function | IEA |
| GO:0008270 | zinc ion binding | mollecular_function | IEA |
| GO:0031072 | heat shock protein binding | mollecular_function | IEA |
| GO:0051087 | chaperone binding | mollecular_function | IEA |
| GO:0005622 | intracellular | cell_component | IDA |
| GO:0005739 | mitochondrion | cell_component | IDA |
| GO:0005783 | endoplasmic reticulum | cell_component | IDA |
| GO:0005829 | cytosol | cell_component | IDA |
| GO:0031966 | mitochondrial membrane | cell_component | IDA |
| GO:0016021 | integral to membrane | cell_component | IEA |
| GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Curated Isoforms [+]
| Transcript | Translation |
|---|---|
| OTTMUST00000076752 * | OTTMUSP00000040454 * |
| OTTMUST00000076753 | OTTMUSP00000040455 |
| OTTMUST00000076754 | OTTMUSP00000044772 |
| OTTMUST00000076755 | OTTMUSP00000044773 |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from MGI [?] MGI:1097161
- Ensembl genome browser [?] : ENSMUSG00000057789
- Expression info from Arrayexpress [?] : ENSMUSG00000057789
- Protein expression from Protein Atlas: [?] ENSMUSG00000057789
- Community gene edition from Wikigenes: [?] 12018
Click on [?] for more information.
