TNFRSFA (Danio rerio)
Description [+]
- Synonyms: TNFRSFA, TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY MEMBER A, OTR, WU:FC27C09, TNF, OVARIAN TNF RECEPTOR
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: tumor necrosis factor receptor superfamily, member a [Source:RefSeq_peptide;Acc:NP_571915]
- Family: Death receptor
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment: Ectopic expression of Tnfrsfa in zebrafish embryos and human cell lines induces apoptosis [16888647] . Tnfrsfa directly associates with the zebrafish Apo2L/TRAIL orthologs Tnfsf10l and Tnfsf10l2 [16888647] .
- WIKI: TNFRSFA-D_rerio
References [+]
- Delineation of the cell-extrinsic apoptosis pathway in the zebrafish.
- Eimon PM, Kratz E, Varfolomeev E, Hymowitz SG, Stern H, Zha J, Ashkenazi A
- The mammalian extrinsic apoptosis pathway is triggered by Fas ligand (FasL) and Apo2 ligand/tumor necrosis factor (TNF)-related apoptosis-inducing ligand (Apo2L/TRAIL). Ligand binding to cognate receptors activates initiator caspases directly in a death-inducing signaling complex. In Drosophila, TNF ligand binding activates initiator caspases indirectly, through JNK. We characterized the extrinsic pathway in zebrafish to determine how it operates in a nonmammalian vertebrate. We identified homologs of FasL and Apo2L/TRAIL, their receptors, and other components of the cell death machinery. Studies with three Apo2L/TRAIL homologs demonstrated that they bind the receptors zHDR (previously linked to hematopoiesis) and ovarian TNFR (zOTR). Ectopic expression of these ligands during embryogenesis induced apoptosis in erythroblasts and notochord cells. Inhibition of zHDR, zOTR, the adaptor zFADD, or caspase-8-like proteases blocked ligand-induced apoptosis, as did antiapoptotic Bcl-2 family members. Thus, the extrinsic apoptosis pathway in zebrafish closely resembles its mammalian counterpart and cooperates with the intrinsic pathway to trigger tissue-specific apoptosis during embryogenesis in response to ectopic Apo2L/TRAIL expression. Cell Death Differ. 2006 Oct;13(10):1619-30. Epub 2006 Aug 4.
- Molecular cloning and expression of a TNF receptor and two TNF ligands in the fish ovary.
- Bobe J, Goetz FW
- Using degenerative primers, partial cDNAs of a TNF (tumor necrosis factor) receptor and two TNF ligands were obtained by PCR of zebrafish and trout cDNAs, or cDNA libraries. These fragments were then used to screen cDNA libraries of appropriate tissues to obtain clones containing full coding sequences. A zebrafish cDNA was obtained that presumably codes for a 438 amino acid ovarian TNF receptor (OTR) that was identified as a death-domain-containing member of the TNF receptor family. On Northern blots, the OTR cDNA hybridized with a 3.4-kb transcript that is abundant in the zebrafish ovary but lightly detected in all other tissues tested. A zebrafish cDNA presumably coding for a 214 amino acid protein with sequence similarity to mammalian TRAIL (TNF-related apoptosis inducing ligand), was also isolated. In addition, a fragment of the brook trout TRAIL homologue was obtained. Finally, a full-length brook trout cDNA, that presumably codes for a 255 amino acid protein with sequence similarity to mammalian TNF-alpha and lymphotoxin-alpha, was isolated. This study is the first report of a death-domain-containing TNF receptor and the first published report of a TNF ligand in fish. Comp Biochem Physiol B Biochem Mol Biol. 2001 Jun;129(2-3):475-81.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNFR_c6 | 83 | 122 |
| PFAM A | Death | 348 | 428 |
Protein sequence [+]
tnfrsfa | Danio rerio | 7955 | length:437
LKTSNVCQTCFKALVIFSLALVGHGAAELGVSADHQNRTARQMTCLENHEYPHNGFCCKN
CEAGTYVKEKCTSGQVMGKCSPCEKGTYAEHPTGMEQCLQCSQCHRDQTVVAECTSTSNT
KCDCKIGTFCLPDEPCEVCKKCTKCKADEEEVSGCTPTSNTKCRRRPSHPTEGPTEKPSA
SNSTGTIVVIVSILILLVICAIVGAILFLKRRQRQQSETDGNLEEVKVPIDECPRSEEEQ
ENSRNAGLEKEEEHRPESRPLLTQETQETGSKSIPVEDEDRGLGDSLPHNQLFPNQSICT
PSNHWGFTDPAPRPRDRPTEIRLNHGHGLEDDPPRKLLPLLGEEESLSKSFDLFDSLDVR
YHNKFFRSIGVSDNSIKLAETQQPMDKVYDLLRVWMQKEGLRANINTLLQALLDLDQRYS
AEHIASKAVERGYYKYE
CEAGTYVKEKCTSGQVMGKCSPCEKGTYAEHPTGMEQCLQCSQCHRDQTVVAECTSTSNT
KCDCKIGTFCLPDEPCEVCKKCTKCKADEEEVSGCTPTSNTKCRRRPSHPTEGPTEKPSA
SNSTGTIVVIVSILILLVICAIVGAILFLKRRQRQQSETDGNLEEVKVPIDECPRSEEEQ
ENSRNAGLEKEEEHRPESRPLLTQETQETGSKSIPVEDEDRGLGDSLPHNQLFPNQSICT
PSNHWGFTDPAPRPRDRPTEIRLNHGHGLEDDPPRKLLPLLGEEESLSKSFDLFDSLDVR
YHNKFFRSIGVSDNSIKLAETQQPMDKVYDLLRVWMQKEGLRANINTLLQALLDLDQRYS
AEHIASKAVERGYYKYE
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| NP_989717.1 | orthology | Chicken |
| T_rubripes_ENSTRUP00000013812 | orthology | Fugu |
| G_aculeatus_ENSGACP00000020911 | orthology | Gasterosteus |
| A_carolinensis_ENSACAP00000000071 | orthology | Lyzard |
| O_latipes_ENSORLP00000003602 | orthology | Medaka |
| TNFRSF10D | orthology | Tetraodon |
| NM_204115.1 | paralogy | Chicken |
| NP_001025950.1 | paralogy | Chicken |
| Q9DGH7_CHICK | paralogy | Chicken |
| TNFRSF14 | paralogy | Chimpanzee |
| TNFRSF10B | paralogy | Chimpanzee |
| TNFRSF10C | paralogy | Chimpanzee |
| CD27 | paralogy | Chimpanzee |
| TNR1A_BOVIN | paralogy | Cow |
| NP_001075903.1 | paralogy | Cow |
| CD27 | paralogy | Dog |
| O97530_CANFA | paralogy | Dog |
| T_rubripes_ENSTRUP00000010129 | paralogy | Fugu |
| TNFRSF21 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000007142 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000011439 | paralogy | Gasterosteus |
| TNFRSF1A | paralogy | Horse |
| E_caballus_ENSECAP00000022015 | paralogy | Horse |
| CD27 | paralogy | Human |
| TRAIL-R2, TNFRSF10B | paralogy | Human |
| TNFRSF14 | paralogy | Human |
| TRAIL-R3 / TNFSF10C | paralogy | Human |
| TNFRSF1A | paralogy | Macaca |
| CD27 | paralogy | Macaca |
| TNFRSF14 | paralogy | Macaca |
| TNFRSF10A | paralogy | Macaca |
| O_latipes_ENSORLP00000020293 | paralogy | Medaka |
| M_domestica_ENSMODP00000011508 | paralogy | Monodelphis |
| TNFRSF1A | paralogy | Monodelphis |
| Tnfrsf10b | paralogy | Mouse |
| Tnfrsf4 | paralogy | Mouse |
| Cd27 | paralogy | Mouse |
| Tnfrsf14 | paralogy | Mouse |
| TNFRSF10D | paralogy | Orangutan |
| TNFRSF10B | paralogy | Orangutan |
| TNFRSF25 | paralogy | Ornithorhynchus |
| Tnfrsf4 | paralogy | Rat |
| MGC112688 | paralogy | Rat |
| Tnfrsf1a | paralogy | Rat |
| Tnfrsf10b | paralogy | Rat |
| EDA2R | paralogy | Xenopus |
| hdr | paralogy | Zebrafish |
| ngfrl | paralogy | Zebrafish |
| fas | paralogy | Zebrafish |
| zgc:153759 | paralogy | Zebrafish |
| LOC572204 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IDA |
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0004872 | receptor activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-010802-1
- Ensembl genome browser [?] : ENSDARG00000004451
- Expression info from Arrayexpress [?] : ENSDARG00000004451
- Protein expression from Protein Atlas: [?] ENSDARG00000004451
- Community gene edition from Wikigenes: [?] 114461
Click on [?] for more information.


