TRAF2 (Homo sapiens)
Description [+]
- Synonyms: TRAF2, TRAP3
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: TNF receptor-associated factor 2 (Tumor necrosis factor type 2 receptor-associated protein 3) [Source:UniProtKB/Swiss-Prot;Acc:Q12933]
- Family: other
- Process: immunity,
- Pathways: TNF/NF-kappaB signaling,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Traf2
- WIKI: TRAF2-H_sapiens
References [+]
- A novel family of putative signal transducers associated with the cytoplasmic domain of the 75 kDa tumor necrosis factor receptor.
- Rothe M, Wong SC, Henzel WJ, Goeddel DV
- Mutational analysis identified a C-terminal region of 78 amino acids within the cytoplasmic domain of the human 75 kDa tumor necrosis factor receptor (TNF-R2) that is required for signal transduction. This region was subsequently shown to mediate the interaction of cytoplasmic factors with TNF-R2. Two of these factors were isolated and molecularly cloned using biochemical purification and the yeast two-hybrid system. TNF receptor-associated factor 1 (TRAF1) and TRAF2 are the first two members of a novel protein family containing a novel C-terminal homology region, the TRAF domain. In addition, TRAF2 contains an N-terminal RING finger motif. TRAF1 and TRAF2 can form homo- and heterotypic dimers. Our analysis indicates that TRAF1 and TRAF2 are associated with the cytoplasmic domain of TNF-R2 in a heterodimeric complex in which TRAF2 contacts the receptor directly. TRAF1 interacts with TNF-R2 indirectly through heterodimer formation with TRAF2. Cell. 1994 Aug 26;78(4):681-92.
- Anatomy of TRAF2. Distinct domains for nuclear factor-kappaB activation and association with tumor necrosis factor signaling proteins.
- Takeuchi M, Rothe M, Goeddel DV
- The tumor necrosis factor (TNF) receptor-associated factor (TRAF) family of proteins interact with and transduce signals for members of the TNF receptor superfamily. TRAF1, TRAF2, and TRAF3 share a conserved C-terminal TRAF domain. TRAF2 plays a key role in transducing signals for activation of the transcription factor nuclear factor-kappaB (NF-kappaB). We have performed extensive mutational analysis on TRAF2, examining the requirements for NF-kappaB activation, self-association, and interaction with other molecules involved in TNF signaling. Examination of point mutants and TRAF2-TRAF3 chimeric proteins indicates that the N-terminal RING finger and two adjacent zinc fingers of TRAF2 are required for NF-kappaB activation. The two distinct TRAF-N and TRAF-C subdomains of the TRAF domain appear to independently mediate self-association and interaction with TRAF1. Interaction of TRAF2 with TNF-R2 and TRADD requires sequences at the C terminus of the TRAF-C domain, whereas interaction with the protein kinase receptor-interacting protein V(RIP) occurs via sequences at the N terminus of the TRAF-C domain. Thus, distinct domains of TRAF2 are involved in recruitment and signaling functions. J Biol Chem. 1996 Aug 16;271(33):19935-42.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | zf-C3HC4 | 34 | 72 |
| PFAM A | zf-TRAF | 178 | 235 |
| PFAM A | MATH | 358 | 498 |
Protein sequence [+]
TRAF2 | Homo sapiens | 9606 | length:501
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
Structure links:
- Smartdomain prediction information: SM00184
- Smartdomain prediction information: SM00061
- Prosite motif and domain information: PS00518
- Profile motif and domain profile information: PS50089
- Profile motif and domain profile information: PS50145
- Profile motif and domain profile information: PS50144
- Interpro domain information: Q12933
- PFAM domain and domain family information: Q12933
- Protein 3D structures from PDB: 1F3V 1D01 1D00 1CZZ 1D0A 1CA9
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| TRAF2 | orthology | Chicken |
| TRAF2 | orthology | Chimpanzee |
| TRAF2 | orthology | Cow |
| TRAF2 | orthology | Dog |
| TRAF2 (2 of 2) | orthology | Fugu |
| TRAF2 (1 of 2) | orthology | Fugu |
| TRAF2 (2 of 2) | orthology | Gasterosteus |
| TRAF2 (1 of 2) | orthology | Gasterosteus |
| TRAF2 | orthology | Gorilla |
| TRAF2 | orthology | Horse |
| TRAF2 | orthology | Lyzard |
| TRAF2 | orthology | Macaca |
| TRAF2 (1 of 2) | orthology | Medaka |
| TRAF2 (2 of 2) | orthology | Medaka |
| TRAF2 | orthology | Monodelphis |
| Traf2 | orthology | Mouse |
| TRAF2 | orthology | Orangutan |
| O_anatinus_ENSOANP00000028670 | orthology | Ornithorhynchus |
| Traf2_predicted | orthology | Rat |
| TRAF2 (2 of 2) | orthology | Tetraodon |
| TRAF2 (1 of 2) | orthology | Tetraodon |
| TRAF2 | orthology | Xenopus |
| TRAF2 | orthology | Zebra finch |
| TRAF2 | orthology | Zebrafish |
| A_aegypti_AAEL006649-PA | paralogy | Aedes |
| A_aegypti_AAEL011363-PA | paralogy | Aedes |
| A_aegypti_AAEL015342-PA | paralogy | Aedes |
| A_gambiae_AGAP003004-PA | paralogy | Anopheles |
| A_gambiae_AGAP010017-PA | paralogy | Anopheles |
| TRAF1 | paralogy | Chicken |
| TRAF6 | paralogy | Chicken |
| NP_989550.1 | paralogy | Chicken |
| TRAF3 | paralogy | Chicken |
| TRAF5 | paralogy | Chimpanzee |
| TRAF6 | paralogy | Chimpanzee |
| TRAF3 | paralogy | Chimpanzee |
| TRAF4 | paralogy | Chimpanzee |
| TRAF1 | paralogy | Chimpanzee |
| C_intestinalis_ENSCINP00000001022 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000001432 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000003143 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000003738 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000005981 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000008928 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000027890 | paralogy | Ciona |
| NP_001098810.1 | paralogy | Cow |
| LOC783305 | paralogy | Cow |
| IPI00716910.2 | paralogy | Cow |
| NP_001029833.1 | paralogy | Cow |
| IPI00843279.1 | paralogy | Cow |
| NP_001094750.1 | paralogy | Cow |
| TRAF6 | paralogy | Dog |
| TRAF5 | paralogy | Dog |
| TRAF3 | paralogy | Dog |
| TRAF4 | paralogy | Dog |
| TRAF1 | paralogy | Dog |
| Traf2 | paralogy | Fly |
| Traf3 | paralogy | Fly |
| Traf1 | paralogy | Fly |
| TRAF4 | paralogy | Fugu |
| TRAF3 | paralogy | Fugu |
| TRAF6 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000047803 | paralogy | Fugu |
| TRAF3 | paralogy | Gasterosteus |
| TRAF4 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000022084 | paralogy | Gasterosteus |
| TRAF6 | paralogy | Gasterosteus |
| TRAF5 | paralogy | Gasterosteus |
| TRAF1 | paralogy | Gorilla |
| TRAF3 | paralogy | Gorilla |
| TRAF6 | paralogy | Gorilla |
| TRAF5 | paralogy | Gorilla |
| TRAF4 | paralogy | Gorilla |
| TRAF5 | paralogy | Horse |
| TRAF1 | paralogy | Horse |
| TRAF4 | paralogy | Horse |
| TRAF3 | paralogy | Horse |
| TRAF6 | paralogy | Horse |
| TRAF4 | paralogy | Human |
| TRAF6 | paralogy | Human |
| TRAF5 | paralogy | Human |
| TRAF1 | paralogy | Human |
| TRAF3 | paralogy | Human |
| TRAF3 | paralogy | Lyzard |
| TRAF6 | paralogy | Lyzard |
| TRAF5 | paralogy | Lyzard |
| A_carolinensis_ENSACAP00000017068 | paralogy | Lyzard |
| TRAF3 | paralogy | Macaca |
| M_mulatta_ENSMMUP00000021905 | paralogy | Macaca |
| M_mulatta_ENSMMUP00000021907 | paralogy | Macaca |
| TRAF1 | paralogy | Macaca |
| TRAF4 | paralogy | Macaca |
| TRAF5 | paralogy | Macaca |
| TRAF4 | paralogy | Medaka |
| O_latipes_ENSORLP00000008989 | paralogy | Medaka |
| TRAF3 | paralogy | Medaka |
| TRAF6 | paralogy | Medaka |
| TRAF5 | paralogy | Medaka |
| TRAF5 | paralogy | Monodelphis |
| TRAF3 | paralogy | Monodelphis |
| TRAF4 | paralogy | Monodelphis |
| TRAF1 | paralogy | Monodelphis |
| TRAF6 | paralogy | Monodelphis |
| Traf6 | paralogy | Mouse |
| Traf4 | paralogy | Mouse |
| Traf3 | paralogy | Mouse |
| Traf1 | paralogy | Mouse |
| Traf5 | paralogy | Mouse |
| TRAF5 | paralogy | Orangutan |
| TRAF6 | paralogy | Orangutan |
| TRAF3 | paralogy | Orangutan |
| TRAF4 | paralogy | Orangutan |
| Q5RAE4_PONPY | paralogy | Orangutan |
| TRAF1 | paralogy | Ornithorhynchus |
| TRAF5 | paralogy | Ornithorhynchus |
| TRAF6 | paralogy | Ornithorhynchus |
| TRAF4 | paralogy | Ornithorhynchus |
| TRAF3 | paralogy | Ornithorhynchus |
| TRAF4 | paralogy | Rabbit |
| TRAF3 | paralogy | Rabbit |
| TRAF1 | paralogy | Rabbit |
| TRAF5 | paralogy | Rabbit |
| TRAF6 | paralogy | Rabbit |
| NP_001101224.1 | paralogy | Rat |
| Traf3_predicted | paralogy | Rat |
| NP_001100487.1 | paralogy | Rat |
| TRAF3 | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000011878 | paralogy | Tetraodon |
| TRAF6 | paralogy | Tetraodon |
| TRAF4 | paralogy | Tetraodon |
| trf-1 | paralogy | Worm |
| traf6 | paralogy | Xenopus |
| TRAF3 | paralogy | Xenopus |
| TRAF5 | paralogy | Xenopus |
| TRAF1 | paralogy | Xenopus |
| traf4 | paralogy | Xenopus |
| TRAF5 | paralogy | Zebra finch |
| TRAF1 | paralogy | Zebra finch |
| TRAF6 | paralogy | Zebra finch |
| TRAF3 | paralogy | Zebra finch |
| traf4b | paralogy | Zebrafish |
| si:dkey-170o10.1 | paralogy | Zebrafish |
| TRAF1 | paralogy | Zebrafish |
| traf4a | paralogy | Zebrafish |
| TRAF5 (2 of 2) | paralogy | Zebrafish |
| traf6 | paralogy | Zebrafish |
| zgc:92367 | paralogy | Zebrafish |
| Q1MT17_DANRE | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0006461 | protein complex assembly | biological_proccess | TAS |
| GO:0007165 | signal transduction | biological_proccess | TAS |
| GO:0008633 | activation of pro-apoptotic gene products | biological_proccess | EXP |
| GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IMP |
| GO:0050870 | positive regulation of T cell activation | biological_proccess | IC |
| GO:0032743 | positive regulation of interleukin-2 production | biological_proccess | IMP |
| GO:0002726 | positive regulation of T cell cytokine production | biological_proccess | IMP |
| GO:0008270 | zinc ion binding | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0004871 | signal transducer activity | mollecular_function | NAS |
| GO:0046872 | metal ion binding | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0005829 | cytosol | cell_component | EXP |
| GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Curated Isoforms [+]
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :12032
- Gene related info from GeneCards [?] : TRAF2
- Ensembl genome browser [?] : ENSG00000127191
- Expression info from Arrayexpress [?] : ENSG00000127191
- Protein expression from Protein Atlas: [?] ENSG00000127191
- Community gene edition from Wikigenes: [?] 7186
- OMIM gene information: 601895
- OMIM disease information:
Click on [?] for more information.
